GapMind for Amino acid biosynthesis

 

Aligments for a candidate for serB in Pseudomonas stutzeri RCH2

Align phosphoserine phosphatase (EC 3.1.3.3) (characterized)
to candidate GFF484 Psest_0489 phosphoserine phosphatase SerB

Query= BRENDA::O53289
         (409 letters)



>lcl|FitnessBrowser__psRCH2:GFF484 Psest_0489 phosphoserine
           phosphatase SerB
          Length = 404

 Score =  251 bits (641), Expect = 3e-71
 Identities = 158/392 (40%), Positives = 221/392 (56%), Gaps = 13/392 (3%)

Query: 7   VLITVTGMDQPGVTSALFEVLAQHGVELLNVEQVVIRGRLTLGVLVSCPLDVADGTALRD 66
           VLI +TG D+PG+T+A+  VLAQ GV +L++ Q VI   L+ G+L+  P +    + L+D
Sbjct: 5   VLINITGEDRPGLTAAITGVLAQGGVNILDIGQAVIHDTLSFGILIEIPDNERASSVLKD 64

Query: 67  DVAAAI---HGVGLDVAIERSDDLPIIRQ-PSTHTIFVLGRPITAGAFSAVARGVAALGV 122
            +         V      E      +  Q    H + +L R +TA     V+   A  G+
Sbjct: 65  VLFMGYKHDQQVRFTPVAEADYQHWVAGQGKPRHIVTLLTRKVTAEQLQRVSSITAKYGL 124

Query: 123 NIDFIRGIS-----DYPVT----GLELRVSVPPGCVGPLQIALTKVAAEEHVDVAVEDYG 173
           NID I  +S     D P       +E  V   P     L+     VA E +VD+A +   
Sbjct: 125 NIDHIDRLSGRMPLDMPEELGKGCIEFSVRGEPADTAALRAEFLSVAQELNVDIAFQRDS 184

Query: 174 LAWRTKRLIVFDVDSTLVQGEVIEMLAARAGAQGQVAAITEAAMRGELDFAESLQRRVAT 233
           +  R +RL VFD+DSTL++ EVI+ LA  AG   QV+ ITE AMRGELDF  S + R+A 
Sbjct: 185 VYRRNRRLAVFDMDSTLIEAEVIDELAKAAGVGEQVSEITERAMRGELDFRASFKERLAL 244

Query: 234 LAGLPATVIDDVAEQLELMPGARTTIRTLRRLGFRCGVVSGGFRRIIEPLARELMLDFVA 293
           L GL   V+ D+   L L  GA      L+RLG++  ++SGGF    + L  +L +D+V 
Sbjct: 245 LEGLSEDVLADIGASLRLTEGAEVLFAELKRLGYKTAILSGGFSYFAKQLQAKLGIDYVF 304

Query: 294 SNELEIVDGILTGRVVGPIVDRPGKAKALRDFASQYGVPMEQTVAVGDGANDIDMLGAAG 353
           +NEL+I +G +TG  V PIVD   KA  LR  A Q G+ +EQT+AVGDGAND+ MLG AG
Sbjct: 305 ANELQIENGKVTGVAVEPIVDAQRKADLLRQLAEQEGLCLEQTIAVGDGANDLPMLGLAG 364

Query: 354 LGIAFNAKPALREVADASLSHPYLDTVLFLLG 385
           LG+AF AKP +++ A  ++S   LD +L+LLG
Sbjct: 365 LGVAFRAKPLVKQSAKQAISTLGLDGILYLLG 396


Lambda     K      H
   0.321    0.139    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 444
Number of extensions: 28
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 1
Length of query: 409
Length of database: 404
Length adjustment: 31
Effective length of query: 378
Effective length of database: 373
Effective search space:   140994
Effective search space used:   140994
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 50 (23.9 bits)

Align candidate GFF484 Psest_0489 (phosphoserine phosphatase SerB)
to HMM TIGR00338 (serB: phosphoserine phosphatase SerB (EC 3.1.3.3))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00338.hmm
# target sequence database:        /tmp/gapView.3475.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00338  [M=219]
Accession:   TIGR00338
Description: serB: phosphoserine phosphatase SerB
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                          -----------
    6.7e-83  263.6   0.3    8.6e-83  263.3   0.3    1.1  1  lcl|FitnessBrowser__psRCH2:GFF484  Psest_0489 phosphoserine phospha


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__psRCH2:GFF484  Psest_0489 phosphoserine phosphatase SerB
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  263.3   0.3   8.6e-83   8.6e-83       1     219 []     177     395 ..     177     395 .. 0.99

  Alignments for each domain:
  == domain 1  score: 263.3 bits;  conditional E-value: 8.6e-83
                          TIGR00338   1 diakselskllkkkklvvfDlDstlieeEvIdeiaklaGveeeVseiTerAmrgeldFkeslreRvkllkglpvel 76 
                                        dia + +s ++++++l+vfD+Dstlie+EvIde+ak+aGv+e+VseiTerAmrgeldF++s++eR++ll gl++++
  lcl|FitnessBrowser__psRCH2:GFF484 177 DIAFQRDSVYRRNRRLAVFDMDSTLIEAEVIDELAKAAGVGEQVSEITERAMRGELDFRASFKERLALLEGLSEDV 252
                                        688899999******************************************************************* PP

                          TIGR00338  77 lkkveeklelteGveelvkkLkekgykvaviSGgFdlvaeklkekLgldavfaNrLevedgkltGkvegeivdesa 152
                                        l  +  +l+lteG+e l  +Lk+ gyk+a++SGgF+++a++l++kLg+d+vfaN+L++e+gk tG    +ivd++ 
  lcl|FitnessBrowser__psRCH2:GFF484 253 LADIGASLRLTEGAEVLFAELKRLGYKTAILSGGFSYFAKQLQAKLGIDYVFANELQIENGKVTGVAVEPIVDAQR 328
                                        **************************************************************************** PP

                          TIGR00338 153 kaktllkllekegislektvavGDGanDlsmikaAglgiafnakpvlkekadiviekkdltdilell 219
                                        ka+ l +l+e+eg+ le+t+avGDGanDl+m+  Aglg+af akp +k+ a+++i++  l +il+ll
  lcl|FitnessBrowser__psRCH2:GFF484 329 KADLLRQLAEQEGLCLEQTIAVGDGANDLPMLGLAGLGVAFRAKPLVKQSAKQAISTLGLDGILYLL 395
                                        **************************************************************99986 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (219 nodes)
Target sequences:                          1  (404 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00
# Mc/sec: 13.51
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory