GapMind for Amino acid biosynthesis

 

Alignments for a candidate for asd in Pseudomonas stutzeri RCH2

Align Aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 (characterized)
to candidate GFF2538 Psest_2588 aspartate-semialdehyde dehydrogenase, gamma-proteobacterial

Query= SwissProt::Q51344
         (370 letters)



>FitnessBrowser__psRCH2:GFF2538
          Length = 370

 Score =  683 bits (1763), Expect = 0.0
 Identities = 336/370 (90%), Positives = 356/370 (96%)

Query: 1   MKRVGLIGWRGMVGSVLMQRMLEERDFDLIEPVFFTTSNVGGQGPEVGKDIAPLKDAYSI 60
           MKRVGLIGWRGMVGSVLMQRMLEERDFDLIEPVFFTTSNVGGQGP++GK+ A LKDAYSI
Sbjct: 1   MKRVGLIGWRGMVGSVLMQRMLEERDFDLIEPVFFTTSNVGGQGPDIGKETAALKDAYSI 60

Query: 61  DELKTLDVILTCQGGDYTSEVFPKLREAGWQGYWIDAASSLRMEDDAVIVLDPVNRKVID 120
           DELK LDVILTCQGGDYT+EVFPKLREAGWQGYWIDAASSLRM+DDAVIVLDPVNR+VID
Sbjct: 61  DELKGLDVILTCQGGDYTNEVFPKLREAGWQGYWIDAASSLRMQDDAVIVLDPVNRRVID 120

Query: 121 QALDAGTRNYIGGNCTVSLMLMALGGLFDAGLVEWMSAMTYQAASGAGAQNMRELLKQMG 180
           Q LDAGT+NYIGGNCTVSL LM LGGLF+AGLVEWMSAMTYQAASGAGAQNMREL+KQMG
Sbjct: 121 QQLDAGTKNYIGGNCTVSLALMGLGGLFEAGLVEWMSAMTYQAASGAGAQNMRELIKQMG 180

Query: 181 AAHASVADDLANPASAILDIDRKVAETLRSEAFPTEHFGAPLGGSLIPWIDKELPNGQSR 240
           A +A+VADDLANPASAILDIDRKVAET RSEAFP ++FG PL GSLIP+IDKELPNGQSR
Sbjct: 181 AINAAVADDLANPASAILDIDRKVAETQRSEAFPVDNFGVPLAGSLIPYIDKELPNGQSR 240

Query: 241 EEWKAQAETNKILARFKNPIPVDGICVRVGAMRCHSQALTIKLNKDVPLTDIEGLISQHN 300
           EEWKAQAETNKIL RFKNPIPVDGICVRVGAMRCHSQALTIKLNKDVP++DIEGLISQHN
Sbjct: 241 EEWKAQAETNKILGRFKNPIPVDGICVRVGAMRCHSQALTIKLNKDVPISDIEGLISQHN 300

Query: 301 PWVKLVPNHREVSVRELTPAAVTGTLSVPVGRLRKLNMGSQYLGAFTVGDQLLWGAAEPL 360
           PWVKLVPNHR+ S++EL+PAAVTGTLSVPVGRLRKLNMGS YLGAFTVGDQLLWGAAEPL
Sbjct: 301 PWVKLVPNHRDASMQELSPAAVTGTLSVPVGRLRKLNMGSHYLGAFTVGDQLLWGAAEPL 360

Query: 361 RRMLRILLER 370
           RRMLRILLER
Sbjct: 361 RRMLRILLER 370


Lambda     K      H
   0.319    0.136    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 634
Number of extensions: 14
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 370
Length of database: 370
Length adjustment: 30
Effective length of query: 340
Effective length of database: 340
Effective search space:   115600
Effective search space used:   115600
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

Align candidate GFF2538 Psest_2588 (aspartate-semialdehyde dehydrogenase, gamma-proteobacterial)
to HMM TIGR01745 (asd: aspartate-semialdehyde dehydrogenase (EC 1.2.1.11))

Software error:

../bin/blast/fastacmd -i /tmp/list.3960.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.3960.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.