Align Tryptophan synthase beta chain 1; EC 4.2.1.20 (characterized, see rationale)
to candidate GFF2586 Psest_2636 tryptophan synthase, beta subunit
Query= uniprot:P50383 (425 letters) >FitnessBrowser__psRCH2:GFF2586 Length = 402 Score = 124 bits (310), Expect = 7e-33 Identities = 113/360 (31%), Positives = 161/360 (44%), Gaps = 55/360 (15%) Query: 72 IGRPTPLFRAKRLEEYLKTPARIYFKYEGATPTGSHKINTAIPQAYFAKEEGIEHVVTET 131 +GRP+P+F A+RL E L A+IY K E TG+HKIN + +A AK G + V+ ET Sbjct: 61 VGRPSPIFHARRLSEQLGG-AQIYLKREDLNHTGAHKINHCLGEALLAKFMGKKKVIAET 119 Query: 132 GAGQWGTAVALAASMYNMKSTIFMVKVSYEQKPMRRSIMQLYGANVYASPTNLTEYGRKI 191 GAGQ G A+A A ++ + I M +V E++ + M++ G + A Sbjct: 120 GAGQHGVALATACALVGIPCEIHMGQVDIEKEHPNVTKMKILGCKLIAV----------- 168 Query: 192 LETNPQHPGSLGIAMSEAIEYALKNEFRYL--VGSVL------DVVLLHQSVIGQETITQ 243 + +L A+ A E LK+ Y+ +GSV+ +V QS+IG E Q Sbjct: 169 ----TRGAATLKEAVDSAFEEYLKDPHNYIYAIGSVVGPHPFPKMVRDFQSIIGTEAREQ 224 Query: 244 -LDLLGEDADILIGCVGGGSNFGGFTYPFIGN---------------KKGKRYIAVSSAE 287 L G D ++ CVGGGSN G F+ + K R+ A S Sbjct: 225 FLAKHGRLPDHVVACVGGGSNAMGMFTAFLEDAAVELVGIEPAGESLDKPGRHSATLSKG 284 Query: 288 IPKFSKGEYKYDFPDSAGLLPLVKMITLGKDYVPPPIYAGGLRYHGVAPTLSLLTKEGIV 347 P G Y D+ G V I A GL Y GV P S L G V Sbjct: 285 KPSELHGMACYVLEDADGNPSAVHSI------------ASGLDYPGVGPQHSYLKDIGRV 332 Query: 348 EWREYNEREIFEAAKIFIENQGIVPAPESAHAIRAVVDEAIEARKNNERKVIVFNLSGHG 407 ++ ++E EA +GI+PA ESAHA+ + A +++ I+ NLSG G Sbjct: 333 NYQTATDQECLEAFMTLSRVEGIIPALESAHAVAWAIRTAPTLSEDSH---ILVNLSGRG 389 Lambda K H 0.318 0.138 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 379 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 402 Length adjustment: 31 Effective length of query: 394 Effective length of database: 371 Effective search space: 146174 Effective search space used: 146174 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate GFF2586 Psest_2636 (tryptophan synthase, beta subunit)
to HMM TIGR00263 (trpB: tryptophan synthase, beta subunit (EC 4.2.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00263.hmm # target sequence database: /tmp/gapView.13124.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00263 [M=385] Accession: TIGR00263 Description: trpB: tryptophan synthase, beta subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9e-167 540.9 0.0 1e-166 540.7 0.0 1.0 1 lcl|FitnessBrowser__psRCH2:GFF2586 Psest_2636 tryptophan synthase, Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__psRCH2:GFF2586 Psest_2636 tryptophan synthase, beta subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 540.7 0.0 1e-166 1e-166 1 383 [. 15 398 .. 15 400 .. 0.99 Alignments for each domain: == domain 1 score: 540.7 bits; conditional E-value: 1e-166 TIGR00263 1 gkfgefGGqyvpevllealeelekayekakkdeefkkeleellkeyagrptpltfaknlskklggakiylkredl 75 g+fg +GGq vp l +a+++++ aye++++ e+f++el l+ +y+grp+p+++a++ls++lgga+iylkredl lcl|FitnessBrowser__psRCH2:GFF2586 15 GYFGPYGGQLVPPHLKQAMDDINLAYEEIRQREDFQQELAALFADYVGRPSPIFHARRLSEQLGGAQIYLKREDL 89 79************************************************************************* PP TIGR00263 76 lhtGahkinnalgqallakrlGkkriiaetGaGqhGvatataaallglecevymGaedverqklnvfrmellgak 150 +htGahkin lg allak +Gkk++iaetGaGqhGva ata+al+g+ ce++mG+ d+e+ ++nv +m++lg k lcl|FitnessBrowser__psRCH2:GFF2586 90 NHTGAHKINHCLGEALLAKFMGKKKVIAETGAGQHGVALATACALVGIPCEIHMGQVDIEKEHPNVTKMKILGCK 164 *************************************************************************** PP TIGR00263 151 vvpvtsGsktlkdavnealrdWvtsvedthyvlGsavGphPfPeivrefqsvigeevkeqilekegrlPdaviac 225 +++vt G +tlk+av++a+ ++ + ++ y +Gs+vGphPfP++vr+fqs+ig+e++eq l+k+grlPd+v+ac lcl|FitnessBrowser__psRCH2:GFF2586 165 LIAVTRGAATLKEAVDSAFEEYLKDPHNYIYAIGSVVGPHPFPKMVRDFQSIIGTEAREQFLAKHGRLPDHVVAC 239 *************************************************************************** PP TIGR00263 226 vGGGsnaiGifaafiedeeveligveagGkGidt.ekhaatlskGkeGvlhGaktkllqdedGqieeahsvsaGl 299 vGGGsna+G+f+af+ed vel+g+e++G+ +d+ +h+atlskGk+ lhG+ ++l d dG+ + +hs+++Gl lcl|FitnessBrowser__psRCH2:GFF2586 240 VGGGSNAMGMFTAFLEDAAVELVGIEPAGESLDKpGRHSATLSKGKPSELHGMACYVLEDADGNPSAVHSIASGL 314 *********************************9789************************************** PP TIGR00263 300 dypgvgPehaalaetgraeyeaitdeealealkllskeeGiipalesshalaaleklapklkkdeivvvnlsGrG 374 dypgvgP+h++l+++gr++y+++td+e+lea+++ls+ eGiipales+ha+a ++++ap+l++d+ ++vnlsGrG lcl|FitnessBrowser__psRCH2:GFF2586 315 DYPGVGPQHSYLKDIGRVNYQTATDQECLEAFMTLSRVEGIIPALESAHAVAWAIRTAPTLSEDSHILVNLSGRG 389 *************************************************************************** PP TIGR00263 375 dkdletvak 383 dkd + va+ lcl|FitnessBrowser__psRCH2:GFF2586 390 DKDADYVAN 398 ***999986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (402 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.85 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory