Align Anthranilate phosphoribosyltransferase; EC 2.4.2.18 (characterized)
to candidate GFF3581 Psest_3648 anthranilate phosphoribosyltransferase
Query= SwissProt::Q8PD71 (345 letters) >FitnessBrowser__psRCH2:GFF3581 Length = 348 Score = 307 bits (786), Expect = 3e-88 Identities = 168/337 (49%), Positives = 216/337 (64%), Gaps = 5/337 (1%) Query: 6 QQALQRTIEHREIFHDEMVDLMRQIMRGEVSDAMVSAILTGLRVKKETIGEIAGAATVMR 65 ++AL R + ++ +EM +MRQIM G+ +DA V A L G+R+K ETI EI GA VMR Sbjct: 4 KEALNRIVGQLDLSTEEMQAVMRQIMTGQCTDAQVGAFLMGMRMKSETIDEIVGAVQVMR 63 Query: 66 EFSRRVEVTDRRHMVDIVGTGGDGSHTFNISTCAMFVAAAGGAKVAKHGNRSVSSKSGSA 125 E + V D +VD GTGGDG + FN+ST A FV AA G KVAKHGNR+VS KSGSA Sbjct: 64 ELAAPVRF-DTDKLVDTCGTGGDGMNIFNVSTAASFVVAAAGGKVAKHGNRAVSGKSGSA 122 Query: 126 DALEALGAVIELQPEQVAASLAQTGIGFMYAPVHHPAMKVVAPVRREMGVRTIFNILGPL 185 D LEA G ++L PEQVA S+ G+GFM+AP HH AMK A RRE+G+RT+FNILGP+ Sbjct: 123 DLLEAAGVFLDLTPEQVARSVDTVGVGFMFAPAHHGAMKHAAGPRRELGLRTLFNILGPM 182 Query: 186 TNPAGSPNILMGVFHPDLVGIQARVLQELGAERALVVWGRDGMDELSLGAGTLVGELRDG 245 NPAG + ++GVF L A VL LG++ LVV +DG+DE+SL A T V EL+DG Sbjct: 183 ANPAGVRHQVLGVFSKALCRPMAEVLARLGSKHVLVVHAQDGLDEISLAAPTHVAELKDG 242 Query: 246 QVHEYEVHPEDFGIAMSASRNLKVADAAESRAMLLQVLDNVPG----PALDIVALNAGAA 301 ++ EY + PEDFGI + L V DA S A++ L A D++ LNAGAA Sbjct: 243 EIREYSIQPEDFGIKSQSLIGLNVEDAQGSLALIRDALGRRQSENGQKAADMIVLNAGAA 302 Query: 302 LYVAGVADSIADGIVRARQVLADGSARACLDAYVAFT 338 LY A +A S+ G+ A L+ G AR L+ V+FT Sbjct: 303 LYAADLASSLKQGVEMAHDALSTGLARDKLEELVSFT 339 Lambda K H 0.320 0.134 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 329 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 345 Length of database: 348 Length adjustment: 29 Effective length of query: 316 Effective length of database: 319 Effective search space: 100804 Effective search space used: 100804 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate GFF3581 Psest_3648 (anthranilate phosphoribosyltransferase)
to HMM TIGR01245 (trpD: anthranilate phosphoribosyltransferase (EC 2.4.2.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01245.hmm # target sequence database: /tmp/gapView.13340.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01245 [M=330] Accession: TIGR01245 Description: trpD: anthranilate phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-130 421.7 2.8 1.2e-130 421.6 2.8 1.0 1 lcl|FitnessBrowser__psRCH2:GFF3581 Psest_3648 anthranilate phosphor Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__psRCH2:GFF3581 Psest_3648 anthranilate phosphoribosyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 421.6 2.8 1.2e-130 1.2e-130 2 329 .. 8 337 .. 7 338 .. 0.97 Alignments for each domain: == domain 1 score: 421.6 bits; conditional E-value: 1.2e-130 TIGR01245 2 eklldnkdLseeeaeqlmkeimsgeasdaqiaAilvalrvkgeteeeiaglakalrekakkvekeeseelvDivG 76 ++++ + dLs+ee++++m++im+g+++daq++A+l+ +r+k+et++ei+g+++++re a v+ + +++lvD++G lcl|FitnessBrowser__psRCH2:GFF3581 8 NRIVGQLDLSTEEMQAVMRQIMTGQCTDAQVGAFLMGMRMKSETIDEIVGAVQVMRELAAPVRFD-TDKLVDTCG 81 7888999*******************************************************995.9******** PP TIGR01245 77 TGGDglktiNiSTasalvaaaaGvkvaKhGnrsvssksGsaDvLealgvnlelspekvarsleevgigFlfAPky 151 TGGDg++ +N+STa+++v+aaaG kvaKhGnr+vs+ksGsaD+Lea gv l+l+pe+vars+++vg+gF+fAP++ lcl|FitnessBrowser__psRCH2:GFF3581 82 TGGDGMNIFNVSTAASFVVAAAGGKVAKHGNRAVSGKSGSADLLEAAGVFLDLTPEQVARSVDTVGVGFMFAPAH 156 *************************************************************************** PP TIGR01245 152 hpalkevapvRkeLgvrtvfNlLGPLlnParaklqvlGvyskdlvevlaevlknlgvkralvvhgedglDEislt 226 h a+k++a+ R+eLg+rt+fN+LGP++nPa +++qvlGv+sk l++ +aevl +lg+k++lvvh++dglDEisl lcl|FitnessBrowser__psRCH2:GFF3581 157 HGAMKHAAGPRRELGLRTLFNILGPMANPAGVRHQVLGVFSKALCRPMAEVLARLGSKHVLVVHAQDGLDEISLA 231 *************************************************************************** PP TIGR01245 227 getkvaelkdgeieeytlspedfglkraeleelkggsaeenaellkevlegke...kkakrdivvlNaaaalyva 298 ++t+vaelkdgei+ey+++pedfg+k ++l l++++a+ +++l++++l ++ ++++d++vlNa+aaly+a lcl|FitnessBrowser__psRCH2:GFF3581 232 APTHVAELKDGEIREYSIQPEDFGIKSQSLIGLNVEDAQGSLALIRDALGRRQsenGQKAADMIVLNAGAALYAA 306 *************************************************655422267889************** PP TIGR01245 299 gkakdlkegvelakeaiksgkalekleelva 329 + a++lk+gve+a++a+++g a +kleelv+ lcl|FitnessBrowser__psRCH2:GFF3581 307 DLASSLKQGVEMAHDALSTGLARDKLEELVS 337 ****************************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (330 nodes) Target sequences: 1 (348 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 11.45 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory