Align L-amino acid N-acyltransferase MnaT; L-methionine N-acyltransferase; L-methionine sulfoximine/L-methionine sulfone N-acetyltransferase; L-phenylglycine N-acetyltransferase; EC 2.3.1.- (characterized)
to candidate PfGW456L13_88 GCN5-related N-acetyltransferase
Query= SwissProt::P76112 (172 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_88 Length = 177 Score = 221 bits (562), Expect = 7e-63 Identities = 110/169 (65%), Positives = 124/169 (73%), Gaps = 1/169 (0%) Query: 3 IRFARKADCAAIAEIYNHAVLYTAAIWNDQTVDADNRIAWFEARTLAGYPVLVS-EENGV 61 IR A AD AI +IYN AVL T AIWN+Q VD NR AWF AR YP+LV + + Sbjct: 5 IRDAVHADLPAIRDIYNDAVLNTTAIWNEQAVDLGNRQAWFSARQSQAYPILVIVDADDT 64 Query: 62 VTGYASFGDWRSFDGFRHTVEHSVYVHPDHQGKGLGRKLLSRLIDEARDCGKHVMVAGIE 121 V GYASFGDWR FDGFRHTVEHSVYV D +G GLG KL+ LI+ ARDCGKHVMVA IE Sbjct: 65 VLGYASFGDWRPFDGFRHTVEHSVYVRSDQRGNGLGPKLMDVLIERARDCGKHVMVAAIE 124 Query: 122 SQNQASLHLHQSLGFVVTAQMPQVGTKFGRWLDLTFMQLQLDERTEPDA 170 S N AS+ LH+ +GF+ T QMPQVGTKFGRWLDLTFMQL L+ +P A Sbjct: 125 SGNAASIRLHERIGFITTGQMPQVGTKFGRWLDLTFMQLTLNPGAQPPA 173 Lambda K H 0.322 0.136 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 121 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 172 Length of database: 177 Length adjustment: 19 Effective length of query: 153 Effective length of database: 158 Effective search space: 24174 Effective search space used: 24174 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory