GapMind for Amino acid biosynthesis


Aligments for a candidate for argA in Pseudomonas fluorescens GW456-L13

Align amino-acid N-acetyltransferase (EC (characterized)
to candidate PfGW456L13_913 N-acetylglutamate synthase (EC

Query= BRENDA::P22567
         (432 letters)

           N-acetylglutamate synthase (EC
          Length = 432

 Score =  750 bits (1936), Expect = 0.0
 Identities = 373/432 (86%), Positives = 404/432 (93%)








Query: 421 FQRNSQVFEKSL 432
Sbjct: 421 YQRNSKIFEKAL 432

Lambda     K      H
   0.321    0.138    0.398 

Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 736
Number of extensions: 14
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 432
Length of database: 432
Length adjustment: 32
Effective length of query: 400
Effective length of database: 400
Effective search space:   160000
Effective search space used:   160000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

Align candidate PfGW456L13_913 (N-acetylglutamate synthase (EC
to HMM TIGR01890 (argA: amino-acid N-acetyltransferase (EC

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020);
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR01890.hmm
# target sequence database:        /tmp/gapView.25851.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01890  [M=429]
Accession:   TIGR01890
Description: N-Ac-Glu-synth: amino-acid N-acetyltransferase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                              Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                              -----------
   2.5e-224  730.9   0.2   2.8e-224  730.7   0.2    1.0  1  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_913  N-acetylglutamate synthase (EC 2

Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_913  N-acetylglutamate synthase (EC
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  730.7   0.2  2.8e-224  2.8e-224       1     429 []       4     432 .]       4     432 .] 1.00

  Alignments for each domain:
  == domain 1  score: 730.7 bits;  conditional E-value: 2.8e-224
                                              TIGR01890   1 fvkwlreaaPyinahrdktlvvglggelvedknlgklvadiallhslGvrlvlvhG 56 
                                                            8******************************************************* PP

                                              TIGR01890  57 arpqieerlakrgrtthyvrGlrvtdeaslelvkeaaGelrlaiearlsmslantp 112
                                                            +rpqie rla+rg+t+hy++G+r+td+a+le+v++a+G+lr aiearlsm++a++p
                                                            ******************************************************** PP

                                              TIGR01890 113 magsrlsvvsGnfvtarPiGvveGvdyehtGevrkidaegirrlldersivllsPl 168
                                                            ******************************************************** PP

                                              TIGR01890 169 gfsvtGeifnlamedvatsvaiklkadklillteedGildadGklvaelsaqeves 224
                                                            g+s+tGeifnla+edvat++ai+l+adkl+l++++ G++d++G+lv+el++q+v +
                                                            ******************************************************** PP

                                              TIGR01890 225 lverleeettarllsaavkalrgGvarshlvsyaedGallqelftrdGiGtlvske 280
                                                            +++rl+++++a+ll+aa++a+rgGvarsh+vsyaedGall+elftrdG Gtlv++e
                                                            ******************************************************** PP

                                              TIGR01890 281 alesireatiddvggilelirPleeqGilvrrsrellereieefsviekdGliigc 336
                                                            ++e++rea i+dvgg+l+li+PleeqGilvrrsre+lereie+fsv+e++G+ii+c
                                                            ******************************************************** PP

                                              TIGR01890 337 aalypyaeeevgelaclavsPeardggrGerllkhiedrarqvGlkrlfvlttrte 392
                                                            aaly +a++++gelaclav+Pe+r+ggrG++ll++ie+rar+ Glk+lfvlttrt+
                                                            ******************************************************** PP

                                              TIGR01890 393 hWfrerGfaeasvdelPearrklynyqrrskilvkkl 429
                                                            hWfrerGf+++svd+lP ar++lynyqr+ski++k l
  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_913 396 HWFRERGFVPSSVDRLPSARASLYNYQRNSKIFEKAL 432
                                                            *********************************9976 PP

Internal pipeline statistics summary:
Query model(s):                            1  (429 nodes)
Target sequences:                          1  (432 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02
# Mc/sec: 7.21

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.



Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory