Align [CysO sulfur-carrier protein]-thiocarboxylate-dependent cysteine synthase (EC 2.5.1.113); O-phosphoserine sulfhydrylase (EC 2.5.1.65) (characterized)
to candidate PfGW456L13_2032 Cysteine synthase B (EC 2.5.1.47)
Query= BRENDA::P9WP53 (323 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2032 Length = 300 Score = 214 bits (545), Expect = 2e-60 Identities = 120/305 (39%), Positives = 177/305 (58%), Gaps = 13/305 (4%) Query: 3 RYDSLLQALGNTPLVGLQRLSPRWDDGRDGPHVRLWAKLEDRNPTGSIKDRPAVRMIEQA 62 +Y ++ +GNTPLV LQRL + L KLE NP GS+KDRPA+ MI +A Sbjct: 4 QYPTIADCVGNTPLVRLQRLPGATSN-------TLLLKLEGNNPAGSVKDRPALSMITRA 56 Query: 63 EADGLLRPGATILEPTSGNTGISLAMAARLKGYRLICVMPENTSVERRQLLELYGAQIIF 122 E G + G T++E TSGNTGI+LAMAA +KGY++I +MP+N+S ER+ + YGA++I Sbjct: 57 ELRGQIHAGDTLIEATSGNTGIALAMAAAIKGYKMILIMPDNSSAERKAAMTAYGAELIL 116 Query: 123 SAAEGGSNTAVATAKELAATNPSWVMLYQYGNPANTDSHYCGTGPELLADLP-EITHFVA 181 + E G A A+++ A V L Q+ N N ++HY TGPE+ ITHFV+ Sbjct: 117 VSQEQGMEGARDLAQKMEAEGQGKV-LDQFANGDNPEAHYTTTGPEIWRQTQGTITHFVS 175 Query: 182 GLGTTGTLMGTGRFLREHVANVKIVAAEPRYGEGVYALRNMDEGFVPELYDPEILTARYS 241 +GTTGT+MG R+L+E NV+I+ +P G + +R + ++P++Y + + Sbjct: 176 SMGTTGTIMGVSRYLKEQNDNVQIIGLQPMEGSAIPGIRRWPQEYLPKIYQADRVDRIVD 235 Query: 242 VGAVDAVRRTRELVHTEGIFAGISTGAVLHAALGVGAGALAAGERADIALVVADAGWKYL 301 + +A TR L EGIF G+S+G + A L + E A I ++ D G +YL Sbjct: 236 MAQSEAEDVTRRLAREEGIFCGVSSGGAVAAMLRLSKEV----ENAVIVAIICDRGDRYL 291 Query: 302 STGAY 306 STG + Sbjct: 292 STGIF 296 Lambda K H 0.317 0.134 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 289 Number of extensions: 10 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 300 Length adjustment: 27 Effective length of query: 296 Effective length of database: 273 Effective search space: 80808 Effective search space used: 80808 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory