Align 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; EC 5.3.1.16; Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (uncharacterized)
to candidate PfGW456L13_359 Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (EC 5.3.1.16)
Query= curated2:B7GVK1 (243 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_359 Length = 245 Score = 322 bits (826), Expect = 3e-93 Identities = 164/241 (68%), Positives = 191/241 (79%), Gaps = 2/241 (0%) Query: 1 MLIIPAIDLKDGKCVRLKQGRMEDDTVFSDDPVATAQHWVNEGARRLHLVDLNGAFAGTP 60 MLIIPAIDLKDG CVRL+QGRMED TVFSDDPV+ A WV G RRLHLVDLNGAF G P Sbjct: 1 MLIIPAIDLKDGACVRLRQGRMEDSTVFSDDPVSMAAKWVEGGCRRLHLVDLNGAFEGQP 60 Query: 61 IHKPVVEAIAKAQPELPIQIGGGIRSLETIEHYLEAGVTFVIIGTKAVQEPEFVEEACKR 120 ++ VV AIAK P LPIQIGGGIRSLETIEHY++AGV++VIIGTKAV++P FV EAC+ Sbjct: 61 VNGEVVTAIAKRYPNLPIQIGGGIRSLETIEHYVKAGVSYVIIGTKAVKDPAFVAEACRA 120 Query: 121 FAGHIIVGIDAMNGMVATDGWANVTDVKATDLAKRFADAGVSSIVYTDIARDGMMQGVNV 180 F G IIVG+DA +G VATDGWA ++ ++ DLAK+F GVSSIVYTDIA+DGMMQG NV Sbjct: 121 FPGKIIVGLDAKDGFVATDGWAEISTIQVIDLAKQFEADGVSSIVYTDIAKDGMMQGCNV 180 Query: 181 EQTVNLAQYSGLPVIASGGVTNLDDVRNL--KGQPGILGAITGRAIYEGTLNLREAQLLL 238 T LA + +PVIASGG+ NL D++ L PGI+GAITGRAIYEGTL++ EAQ Sbjct: 181 PFTAALAAATKIPVIASGGIHNLGDIKTLLDAKAPGIIGAITGRAIYEGTLDVAEAQAFC 240 Query: 239 D 239 D Sbjct: 241 D 241 Lambda K H 0.319 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 279 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 243 Length of database: 245 Length adjustment: 24 Effective length of query: 219 Effective length of database: 221 Effective search space: 48399 Effective search space used: 48399 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
Align candidate PfGW456L13_359 (Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (EC 5.3.1.16))
to HMM TIGR00007 (hisA: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase (EC 5.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00007.hmm # target sequence database: /tmp/gapView.27163.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00007 [M=231] Accession: TIGR00007 Description: TIGR00007: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.6e-81 257.3 0.4 7.5e-81 257.1 0.4 1.0 1 lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_359 Phosphoribosylformimino-5-aminoi Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_359 Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 257.1 0.4 7.5e-81 7.5e-81 1 230 [. 3 235 .. 3 236 .. 0.96 Alignments for each domain: == domain 1 score: 257.1 bits; conditional E-value: 7.5e-81 TIGR00007 1 iiPaiDlkeGkvvrlvqGdkdkktvysddpleaakkfeeegaellHvVDLdgAkeg 56 iiPaiDlk+G++vrl qG+++ +tv+sddp+ +a+k+ e g ++lH+VDL+gA+eg lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_359 3 IIPAIDLKDGACVRLRQGRMEDSTVFSDDPVSMAAKWVEGGCRRLHLVDLNGAFEG 58 8******************************************************* PP TIGR00007 57 ekknlevikkiveel.evkvqvGGGiRsleavekllelgverviigtaavenpelv 111 +++n ev+ i+++ ++++q+GGGiRsle++e+++++gv++viigt+av++p++v lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_359 59 QPVNGEVVTAIAKRYpNLPIQIGGGIRSLETIEHYVKAGVSYVIIGTKAVKDPAFV 114 ***********9876489************************************** PP TIGR00007 112 kellkelgsekivvslDakegevavkGWkekselslvelakkleelgleeiilTdi 167 +e+ +++ ki+v+lDak+g va+ GW+e s++++++lak++e g+++i++Tdi lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_359 115 AEACRAFP-GKIIVGLDAKDGFVATDGWAEISTIQVIDLAKQFEADGVSSIVYTDI 169 *******9.9********************************************** PP TIGR00007 168 ekdGtlsGvnveltkelvkeaeveviasGGvssiedvkalkk...lgvkgvivGkA 220 +kdG+++G nv t l+++++++viasGG+++ d+k+l + g+ g+i G+A lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_359 170 AKDGMMQGCNVPFTAALAAATKIPVIASGGIHNLGDIKTLLDakaPGIIGAITGRA 225 **************************************9866333788889***** PP TIGR00007 221 lyegklklke 230 +yeg+l++ e lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_359 226 IYEGTLDVAE 235 ******9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (231 nodes) Target sequences: 1 (245 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 8.91 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory