Align 3-isopropylmalate dehydratase small subunit; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase; EC 4.2.1.33 (characterized)
to candidate PfGW456L13_3593 3-isopropylmalate dehydratase small subunit (EC 4.2.1.33)
Query= SwissProt::Q1MA52 (202 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3593 Length = 202 Score = 192 bits (487), Expect = 5e-54 Identities = 95/200 (47%), Positives = 132/200 (66%) Query: 1 MDKFVKLTGVAAPLPVVNVDTDMIIPKDYLKTIKRTGLGTGLFAEARYNEDGSENPDFVL 60 M F ++G AAPL N+DTD+I+PK +LK I R GL GLF + R+ E G NP F+L Sbjct: 1 MQPFDFVSGSAAPLLASNIDTDVIMPKQFLKGIDRKGLDKGLFFDLRFLESGEPNPGFIL 60 Query: 61 NKPAYRDAKILVAGDNFGCGSSREHAPWALLDFGIRCVISTSFADIFYNNCFKNGILPIK 120 N+PA+ DA LV G NFGCGSSREHA W L GIR +I TSFA IFY+NC +NG+L I+ Sbjct: 61 NQPAWNDAAFLVVGPNFGCGSSREHAVWGLKQVGIRALIGTSFAGIFYDNCQRNGVLAIQ 120 Query: 121 VSQEDLDKLMDDASRGSNAILTVDLENLEITGPDGGLIKFDLDEFKRHCLLNGLDDIGLT 180 +++ L+++ S + A ++V+L I DG +I F +DE ++ LL GLD +G T Sbjct: 121 LTEVQLNQIAALTSNPATARISVNLPEQTIELADGNVIPFGIDELRKQSLLLGLDAVGTT 180 Query: 181 LEKGKAIDSFEKKNAASHPW 200 L++ + I SFE ++ A +PW Sbjct: 181 LQRAEQIRSFEARHLAENPW 200 Lambda K H 0.319 0.140 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 126 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 202 Length of database: 202 Length adjustment: 21 Effective length of query: 181 Effective length of database: 181 Effective search space: 32761 Effective search space used: 32761 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
Align candidate PfGW456L13_3593 (3-isopropylmalate dehydratase small subunit (EC 4.2.1.33))
to HMM TIGR00171 (leuD: 3-isopropylmalate dehydratase, small subunit (EC 4.2.1.33))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00171.hmm # target sequence database: /tmp/gapView.12171.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00171 [M=188] Accession: TIGR00171 Description: leuD: 3-isopropylmalate dehydratase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.4e-63 198.3 0.0 6.1e-63 198.1 0.0 1.0 1 lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3593 3-isopropylmalate dehydratase sm Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3593 3-isopropylmalate dehydratase small subunit (EC 4.2.1.33) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 198.1 0.0 6.1e-63 6.1e-63 1 188 [] 1 187 [. 1 187 [. 0.97 Alignments for each domain: == domain 1 score: 198.1 bits; conditional E-value: 6.1e-63 TIGR00171 1 mkefkkltGlvvpldkanvdtdaiipkqflkkikrtGfgkhlfyewryldekGke 55 m++f +G ++pl + n+dtd i+pkqflk i+r G++k lf++ r+l e G e lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3593 1 MQPFDFVSGSAAPLLASNIDTDVIMPKQFLKGIDRKGLDKGLFFDLRFL-ESG-E 53 899999******************************************6.567.9 PP TIGR00171 56 pnpefvlnvpqyqgasillarenfGcGssrehapwalkdyGfkviiapsfadify 110 pnp f+ln+p +++a l+++ nfGcGssreha w lk+ G++ +i sfa ify lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3593 54 PNPGFILNQPAWNDAAFLVVGPNFGCGSSREHAVWGLKQVGIRALIGTSFAGIFY 108 ******************************************************* PP TIGR00171 111 nnsfkngllpirlseeeveellalvknkg.lkltvdleaqkvkdsegkvysfeid 164 +n+ +ng+l i+l+e +++++ al +n++ +++v+l++q+++ ++g+v+ f id lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3593 109 DNCQRNGVLAIQLTEVQLNQIAALTSNPAtARISVNLPEQTIELADGNVIPFGID 163 **************************875279*********************** PP TIGR00171 165 efrkhcllnGldeigltlqkedei 188 e rk+ ll Gld +g tlq+ ++i lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3593 164 ELRKQSLLLGLDAVGTTLQRAEQI 187 ********************9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (188 nodes) Target sequences: 1 (202 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 6.24 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory