Align dihydrodipicolinate reductase; EC 1.3.1.26 (characterized)
to candidate PfGW456L13_5101 4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8)
Query= CharProtDB::CH_002128 (273 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_5101 Length = 267 Score = 342 bits (876), Expect = 7e-99 Identities = 174/264 (65%), Positives = 204/264 (77%) Query: 7 RVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGVTVQSSL 66 R+A+ GA GRMG+ LI+A G L AA++R S+L+G+DAGELA G+ GV + L Sbjct: 3 RIAVMGAAGRMGKTLIEAVQQTPGAGLTAAVDRPDSTLVGADAGELAALGRIGVPLSGDL 62 Query: 67 DAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAADIAIVFA 126 D V D+FDV IDFT P TL +LAFCR+HGK M+IGTTGF KQ + +A DI IVFA Sbjct: 63 DRVVDEFDVLIDFTHPTVTLKNLAFCRKHGKAMIIGTTGFSVEEKQLLAEAGKDIPIVFA 122 Query: 127 ANFSVGVNVMLKLLEKAAKVMGDYTDIEIIEAHHRHKVDAPSGTALAMGEAIAHALDKDL 186 ANFSVGVN+ LKLL+ AA+V+GD DIEI EAHHRHKVDAPSGTA+ MGE IA AL +DL Sbjct: 123 ANFSVGVNLCLKLLDTAARVLGDDVDIEITEAHHRHKVDAPSGTAVRMGEVIADALGRDL 182 Query: 187 KDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKASSRMTFANG 246 K AVY REG TG R TIGFATVRAGDIVG+HT +FA GER+EITHKASSRMTFA G Sbjct: 183 KKVAVYGREGQTGARDRETIGFATVRAGDIVGDHTVLFAADGERVEITHKASSRMTFAKG 242 Query: 247 AVRSALWLSGKESGLFDMRDVLDL 270 AVR+ALWL G+E GL+DM+DVLDL Sbjct: 243 AVRAALWLDGREPGLYDMQDVLDL 266 Lambda K H 0.319 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 276 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 267 Length adjustment: 25 Effective length of query: 248 Effective length of database: 242 Effective search space: 60016 Effective search space used: 60016 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate PfGW456L13_5101 (4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8))
to HMM TIGR00036 (dapB: 4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00036.hmm # target sequence database: /tmp/gapView.20219.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00036 [M=270] Accession: TIGR00036 Description: dapB: 4-hydroxy-tetrahydrodipicolinate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-105 338.3 2.1 2e-105 338.1 2.1 1.0 1 lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_5101 4-hydroxy-tetrahydrodipicolinate Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_5101 4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 338.1 2.1 2e-105 2e-105 3 270 .] 3 265 .. 1 265 [. 0.99 Alignments for each domain: == domain 1 score: 338.1 bits; conditional E-value: 2e-105 TIGR00036 3 kvavaGaaGrmGrevikavkeaedlelvaalerkgsskqgkDiGelagigkvgvp 57 ++av GaaGrmG+ +i+av+++++ l+aa++r++s ++g D+Gela +g++gvp lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_5101 3 RIAVMGAAGRMGKTLIEAVQQTPGAGLTAAVDRPDSTLVGADAGELAALGRIGVP 57 89***************************************************** PP TIGR00036 58 veddleavkvlaekkadvliDfttpeavlenvkialekgvrlVvGTTGfseedlk 112 ++ dl+ v +++dvliDft+p +l+n++++ ++g+ +++GTTGfs e+++ lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_5101 58 LSGDLDRV----VDEFDVLIDFTHPTVTLKNLAFCRKHGKAMIIGTTGFSVEEKQ 108 ******99....9****************************************** PP TIGR00036 113 elkdlaekkgvalviapNfaiGvnlllkllekaakvledv.DiEiiElHHrhKkD 166 l+++ ++ +++v+a+Nf++Gvnl lkll +aa+vl+d DiEi E+HHrhK+D lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_5101 109 LLAEAGKD--IPIVFAANFSVGVNLCLKLLDTAARVLGDDvDIEITEAHHRHKVD 161 *****999..***************************8644************** PP TIGR00036 167 aPSGTAlklaeiiakargkdlkeaaveeregltGerkkeeiGiaavRggdvvgeh 221 aPSGTA++++e+ia+a g+dlk++av++reg tG+r +e+iG+a+vR+gd+vg+h lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_5101 162 APSGTAVRMGEVIADALGRDLKKVAVYGREGQTGARDRETIGFATVRAGDIVGDH 216 ******************************************************* PP TIGR00036 222 tvlFasdGerleitHkassRaafakGvvrairwledkeekvydledvld 270 tvlFa dGer+eitHkassR++fakG+vra+ wl e ++yd++dvld lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_5101 217 TVLFAADGERVEITHKASSRMTFAKGAVRAALWLDGREPGLYDMQDVLD 265 ***********************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (267 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 9.91 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory