Align Homoaconitase small subunit; HACN; Homoaconitate hydratase; EC 4.2.1.36 (characterized)
to candidate PfGW456L13_3593 3-isopropylmalate dehydratase small subunit (EC 4.2.1.33)
Query= SwissProt::Q9ZND9 (163 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3593 Length = 202 Score = 52.8 bits (125), Expect = 3e-12 Identities = 42/109 (38%), Positives = 57/109 (52%), Gaps = 16/109 (14%) Query: 11 INTDDILPGKYAPFMVGEDRFHLYA--FAHLRPEFAKEVRPGDIL-----------VFGR 57 I+TD I+P + F+ G DR L F LR + E PG IL V G Sbjct: 19 IDTDVIMPKQ---FLKGIDRKGLDKGLFFDLRFLESGEPNPGFILNQPAWNDAAFLVVGP 75 Query: 58 NAGLGSSREYAPEALKRLGVRAIIAKSYARIFFRNLVNLGIVPFESEEV 106 N G GSSRE+A LK++G+RA+I S+A IF+ N G++ + EV Sbjct: 76 NFGCGSSREHAVWGLKQVGIRALIGTSFAGIFYDNCQRNGVLAIQLTEV 124 Lambda K H 0.322 0.144 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 66 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 163 Length of database: 202 Length adjustment: 19 Effective length of query: 144 Effective length of database: 183 Effective search space: 26352 Effective search space used: 26352 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory