GapMind for Amino acid biosynthesis

 

Alignments for a candidate for argA in Pseudomonas fluorescens GW456-L13

Align amino-acid N-acetyltransferase (EC 2.3.1.1) (characterized)
to candidate PfGW456L13_913 N-acetylglutamate synthase (EC 2.3.1.1)

Query= BRENDA::P22567
         (432 letters)



>FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_913
          Length = 432

 Score =  750 bits (1936), Expect = 0.0
 Identities = 373/432 (86%), Positives = 404/432 (93%)

Query: 1   MPDYVNWLRHASPYINSHRDRTFVVMLPGEGVEHPNFGNIVHDLVLLHSLGARLVLVHGS 60
           MP+YVNWLRHASPYIN+HRD TFVVMLPG+GVEHPNFGNIVHDLVLLHSLG RLVLVHGS
Sbjct: 1   MPEYVNWLRHASPYINAHRDCTFVVMLPGDGVEHPNFGNIVHDLVLLHSLGVRLVLVHGS 60

Query: 61  RPQIEARLAARGLAPRYHRDLRVTDAPTLECVIDAVGSLRIAIEARLSMDMAASPMQGAR 120
           RPQIEARLAARGL P YH  +R+TDA TLECVIDAVG LRIAIEARLSMDMA+SPMQG+R
Sbjct: 61  RPQIEARLAARGLTPHYHHGMRITDAATLECVIDAVGQLRIAIEARLSMDMASSPMQGSR 120

Query: 121 LRVAGGNLVTARPIGVVEGVDYHHTGEVRRIDRKGIGRLLDERSIVLLSPLGYSPTGEIF 180
           LRVA GNLVTARPIGV+EGVDYHHTGEVRR+DRKGI RLLDERSIVLLSPLGYSPTGEIF
Sbjct: 121 LRVASGNLVTARPIGVLEGVDYHHTGEVRRVDRKGINRLLDERSIVLLSPLGYSPTGEIF 180

Query: 181 NLACEDVAMRAAIDLEAEKLILYGAEQGLLDASGKLVRELRPQQVPAHLQRLGNSYQAEL 240
           NLACEDVA RAAIDL A+KL+L+GA+ GL+D  G+LVRELRPQQVPAHLQRLG++YQAEL
Sbjct: 181 NLACEDVATRAAIDLGADKLLLFGADLGLIDEHGRLVRELRPQQVPAHLQRLGSNYQAEL 240

Query: 241 LDAAAQACRAGVKRSHIVSYTEDGALLSELFTRTGNGTLVAQEQFEQLREAGIEDVGGLI 300
           LDAAA+ACR GV RSHIVSY EDGALL+ELFTR G GTLVAQEQFE +REA IEDVGGL+
Sbjct: 241 LDAAAEACRGGVARSHIVSYAEDGALLTELFTRDGGGTLVAQEQFEVVREAAIEDVGGLL 300

Query: 301 ELIRPLEEQGILVRRSREVLEREIEQFSIVEREGLIIACAALYPIADSEAGELACLAVNP 360
           +LI PLEEQGILVRRSREVLEREIEQFS+VEREG+IIACAALY IADS+AGELACLAVNP
Sbjct: 301 DLISPLEEQGILVRRSREVLEREIEQFSVVEREGMIIACAALYQIADSDAGELACLAVNP 360

Query: 361 EYRHGGRGDELLERIEERARGLGLKTLFVLTTRTAHWFRERGFQPSSVERLPAARASLYN 420
           EYRHGGRGDELLERIE RAR  GLKTLFVLTTRTAHWFRERGF PSSV+RLP+ARASLYN
Sbjct: 361 EYRHGGRGDELLERIETRARAQGLKTLFVLTTRTAHWFRERGFVPSSVDRLPSARASLYN 420

Query: 421 FQRNSQVFEKSL 432
           +QRNS++FEK+L
Sbjct: 421 YQRNSKIFEKAL 432


Lambda     K      H
   0.321    0.138    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 736
Number of extensions: 14
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 432
Length of database: 432
Length adjustment: 32
Effective length of query: 400
Effective length of database: 400
Effective search space:   160000
Effective search space used:   160000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

Align candidate PfGW456L13_913 (N-acetylglutamate synthase (EC 2.3.1.1))
to HMM TIGR01890 (argA: amino-acid N-acetyltransferase (EC 2.3.1.1))

Software error:

../bin/blast/fastacmd -i /tmp/list.3139.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.3139.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.