Align low-specificity L-threonine aldolase (EC 4.1.2.48) (characterized)
to candidate Pf1N1B4_3449 Low-specificity L-threonine aldolase (EC 4.1.2.48)
Query= BRENDA::P75823 (333 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3449 Length = 334 Score = 374 bits (961), Expect = e-108 Identities = 189/330 (57%), Positives = 247/330 (74%), Gaps = 1/330 (0%) Query: 1 MIDLRSDTVTRPSRAMLEAMMAAPVGDDVYGDDPTVNALQDYAAELSGKEAAIFLPTGTQ 60 +IDLRSDTVT+P+ ML+AM A GDDVYG+DPTVN L+ A G A+F+PTGT Sbjct: 3 VIDLRSDTVTQPTAGMLDAMANAATGDDVYGEDPTVNRLEAELARRLGFAQALFVPTGTM 62 Query: 61 ANLVALLSHCERGEEYIVGQAAHNYLFEAGGAAVLGSIQPQPIDAAADGTLPLDKVAMKI 120 +NL+ L++HC+RG+EYIVGQ AH Y +E GGAAVLGSIQPQP++ ADG+L L +VA I Sbjct: 63 SNLLGLMAHCDRGDEYIVGQQAHTYKYEGGGAAVLGSIQPQPLEVQADGSLDLAQVAAAI 122 Query: 121 KPDDIHFARTKLLSLENTHNGKVLPREYLKEAWEFTRERNLALHVDGARIFNAVVAYGCE 180 KPDD HFART+LL+LENT GKVLP EYL A FTRE LALH+DGAR++NA V G + Sbjct: 123 KPDDFHFARTRLLALENTMQGKVLPLEYLARARRFTRENGLALHLDGARLYNAAVKLGVD 182 Query: 181 LKEITQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGIY 240 +EITQ+ DS ++CLSKGLG P+GS+L G+ + I +A R RKM GGGMRQ+GILAAAG+Y Sbjct: 183 AREITQHFDSVSVCLSKGLGAPIGSVLCGSVELIAKARRLRKMVGGGMRQAGILAAAGLY 242 Query: 241 ALKNNVARLQEDHDNAAWMAEQLREAGADVMRQDTNMLFVRVGEENAAALGEYMKARNVL 300 AL N+V RL +DH NA +AE LR AG +V TNM++V++G++ A A+ + R + Sbjct: 243 ALDNHVQRLADDHANAQKLAEGLRAAGYEVEPVQTNMVYVQMGDK-AEAIKAFAATRGIK 301 Query: 301 INASPIVRLVTHLDVSREQLAEVAAHWRAF 330 ++A+ +R+VTH+DVSR Q+ +V A + F Sbjct: 302 LSAAGRLRMVTHMDVSRAQIEQVVATFTDF 331 Lambda K H 0.319 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 346 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 333 Length of database: 334 Length adjustment: 28 Effective length of query: 305 Effective length of database: 306 Effective search space: 93330 Effective search space used: 93330 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory