GapMind for Amino acid biosynthesis

 

Alignments for a candidate for ilvI in Pseudomonas fluorescens FW300-N1B4

Align acetolactate synthase (subunit 1/2) (EC 2.2.1.6) (characterized)
to candidate Pf1N1B4_2879 Acetolactate synthase small subunit (EC 2.2.1.6)

Query= BRENDA::P00894
         (163 letters)



>FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2879
          Length = 163

 Score =  210 bits (534), Expect = 1e-59
 Identities = 102/162 (62%), Positives = 137/162 (84%), Gaps = 1/162 (0%)

Query: 1   MRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLSRMTIQTVGDEKVLEQI 60
           MR I+S+LLENE GALSRV+GLFSQR YNIESLTVAPT+DPTLSR+T+ TVG ++V+EQI
Sbjct: 1   MRHIISLLLENEPGALSRVVGLFSQRNYNIESLTVAPTEDPTLSRLTLTTVGHDEVIEQI 60

Query: 61  EKQLHKLVDVLRVSELGQGAHVEREIMLVKIQASGYGRDEVKRNTEIFRGQIIDVTPSLY 120
            K L+KL++V+++ +L + AH+ERE+MLVK++A+G  R E+KR T+I+RGQI+DV+ S+Y
Sbjct: 61  TKNLNKLIEVVKLVDLSESAHIERELMLVKVKATGAQRAEIKRTTDIYRGQIVDVSASVY 120

Query: 121 TVQLAGTSGKLDAFLASIRDVAKIVEVARSGVVGLSRGDKIM 162
           TVQL GTS KLD+F+ SI   A I+E  RSGV G++RGDK++
Sbjct: 121 TVQLTGTSDKLDSFIQSI-GTASILETVRSGVTGIARGDKVL 161


Lambda     K      H
   0.318    0.136    0.360 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 125
Number of extensions: 2
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 163
Length of database: 163
Length adjustment: 18
Effective length of query: 145
Effective length of database: 145
Effective search space:    21025
Effective search space used:    21025
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 43 (21.2 bits)

Align candidate Pf1N1B4_2879 (Acetolactate synthase small subunit (EC 2.2.1.6))
to HMM TIGR00119 (ilvN: acetolactate synthase, small subunit (EC 2.2.1.6))

Software error:

../bin/blast/fastacmd -i /tmp/list.808.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.808.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.