GapMind for Amino acid biosynthesis

 

Alignments for a candidate for ilvE in Pseudomonas fluorescens FW300-N1B4

Align Branched-chain amino acid aminotransferase (EC 2.6.1.42) (characterized)
to candidate Pf1N1B4_4476 Branched-chain amino acid aminotransferase (EC 2.6.1.42)

Query= reanno::pseudo5_N2C3_1:AO356_22970
         (339 letters)



>FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4476
          Length = 339

 Score =  671 bits (1730), Expect = 0.0
 Identities = 324/339 (95%), Positives = 332/339 (97%)

Query: 1   MGNESINWDKLGFDYIKTDKRYLSHWRDGAWDAGTLTDDNVLHISEGSTALHYGQQCFEG 60
           MGNESINWDKLGFDYIKTDKRYLSHWR+G WD GTLT+DNVLHISEGSTALHYGQQCFEG
Sbjct: 1   MGNESINWDKLGFDYIKTDKRYLSHWRNGEWDKGTLTEDNVLHISEGSTALHYGQQCFEG 60

Query: 61  LKAYRCKDGSINLFRPDQNAARMQRSCARLLMPQVETEQFVEACKQVVRANERFIPPYGT 120
           LKAYRCKDGSINLFRPDQNAARMQRSCARLLMPQV TEQFVEACK+VVRANERFIPPYGT
Sbjct: 61  LKAYRCKDGSINLFRPDQNAARMQRSCARLLMPQVSTEQFVEACKEVVRANERFIPPYGT 120

Query: 121 GGALYLRPFVIGVGDNIGVRTAPEFIFSIFCIPVGAYFKGGLTPHNFLISSFDRAAPQGT 180
           GGALYLRPFVIGVGDNIGVRTAPEFIFSIFCIPVGAYFKGGLTPHNFLISS+DRAAPQGT
Sbjct: 121 GGALYLRPFVIGVGDNIGVRTAPEFIFSIFCIPVGAYFKGGLTPHNFLISSYDRAAPQGT 180

Query: 181 GAAKVGGNYAASLMPGSQAKKASFADCIYLDPMTHSKIEEVGSANFFGITHDNTFVTPRS 240
           GAAKVGGNYAASLMPGSQAKKA FADCIYLDP+TH+KIEEVGSANFFGITHDN FVTP S
Sbjct: 181 GAAKVGGNYAASLMPGSQAKKAHFADCIYLDPLTHTKIEEVGSANFFGITHDNKFVTPNS 240

Query: 241 PSVLPGITRLSLIELAKSRLGLEVIEGDVFIDKLSDFKEAGACGTAAVITPIGGISYKDK 300
           PSVLPGITRLSLIELAK+RLGLEV+EGDVFIDKLSDFKEAGACGTAAVITPIGGISY DK
Sbjct: 241 PSVLPGITRLSLIELAKTRLGLEVVEGDVFIDKLSDFKEAGACGTAAVITPIGGISYNDK 300

Query: 301 LHVFHSETEVGPITQKLYKELTGVQTGDVEAPAGWIVKV 339
           LHVFHSETEVGPITQKLYKELTGVQTGDVEAPAGWIVKV
Sbjct: 301 LHVFHSETEVGPITQKLYKELTGVQTGDVEAPAGWIVKV 339


Lambda     K      H
   0.320    0.138    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 574
Number of extensions: 14
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 339
Length of database: 339
Length adjustment: 28
Effective length of query: 311
Effective length of database: 311
Effective search space:    96721
Effective search space used:    96721
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

Align candidate Pf1N1B4_4476 (Branched-chain amino acid aminotransferase (EC 2.6.1.42))
to HMM TIGR01123 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))

Software error:

../bin/blast/fastacmd -i /tmp/list.27239.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.27239.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.