Align Succinyl-diaminopimelate desuccinylase 2; SDAP desuccinylase 2; EC 3.5.1.18; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase 2 (uncharacterized)
to candidate Pf1N1B4_4930 Acetylornithine deacetylase (EC 3.5.1.16)
Query= curated2:A3QGR1 (377 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4930 Length = 385 Score = 86.3 bits (212), Expect = 1e-21 Identities = 73/242 (30%), Positives = 119/242 (49%), Gaps = 20/242 (8%) Query: 22 QWLGERLVAMGFDVSHYQDKG--VSNLLASFDERPAQ-LALAGHTDVVPPGDLSRWQTPP 78 +++ + L++ G + QD+ +NL AS + + L+GHTDVVP + W P Sbjct: 28 EYVRDLLLSKGIESLIVQDETGKKANLFASTGPKELPGILLSGHTDVVPAAGQA-WTFPA 86 Query: 79 FAATLVDGMLIGRGAVDMKSGLAVMLAAVEDHIACYGLPKANWQFIVTSDEEGEAEHGTR 138 F AT+ DG + GRG+ DMK +A+ + A+ D A + L + Q ++ DEE G R Sbjct: 87 FQATVQDGRIYGRGSCDMKGFIALAIDAMLD-AADHSLSRP-LQIALSHDEETGCV-GVR 143 Query: 139 TLVERLKAQSRLPKYCVVAEPTADKQAGDVIKIGRRGAISARLTLKGKQGHVAYPKNAVN 198 L++ L S P C++ EPT + +G +G S R +G + H + +VN Sbjct: 144 RLLDVLHLASVRPFLCLIGEPTNMQ-----FVLGHKGKGSYRTYCRGLEAHSSLAPRSVN 198 Query: 199 ALHMAA-------RVMQALEALIWDEGSDDFPGTSLQVTHVDSGAFTDNIVPGSCEICFN 251 A+H+A + Q L+A + D P +++ V + G NIVP C + F Sbjct: 199 AIHVACDFIAALRQSQQQLQAQGAQDADYDVPYSTVHVGQIVGGKAL-NIVPNLCTLDFE 257 Query: 252 IR 253 +R Sbjct: 258 VR 259 Lambda K H 0.320 0.135 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 289 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 385 Length adjustment: 30 Effective length of query: 347 Effective length of database: 355 Effective search space: 123185 Effective search space used: 123185 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory