Align 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase; EC 2.3.1.89; Tetrahydrodipicolinate N-acetyltransferase; THP acetyltransferase; Tetrahydropicolinate acetylase (uncharacterized)
to candidate Pf1N1B4_1226 FIG01201438: hypothetical protein
Query= curated2:Q5HPE5 (240 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1226 Length = 323 Score = 67.4 bits (163), Expect = 3e-16 Identities = 44/131 (33%), Positives = 68/131 (51%), Gaps = 12/131 (9%) Query: 107 IEDGAVVMMGATINIGAIVGEGTMID-----MNATLGGRATTG-----KNVHVGAGAVLA 156 ++D VV + TI+ G+ +G I N LG G + V +G ++LA Sbjct: 1 VDDTNVVEVLTTIDSGSELGRHVWIRAASRLQNVQLGDDCFVGFKSDLRFVAIGKASMLA 60 Query: 157 GVIE--PPSASPVVIEDNVLIGANAVILEGVRVGAGAIVAAGAIVTQDVPAGAVVAGTPA 214 ++ + SP+ I N +GA + GV +GAGA+VAAGA+V D+P A+ G PA Sbjct: 61 TGVQCLGTAQSPIQIGANAWLGAKVTVKAGVSIGAGAVVAAGALVVSDIPPDAIAVGRPA 120 Query: 215 KVIKQTSEVQD 225 ++I S V+D Sbjct: 121 RIIAYRSVVED 131 Score = 41.2 bits (95), Expect = 3e-08 Identities = 33/125 (26%), Positives = 58/125 (46%), Gaps = 8/125 (6%) Query: 104 QAIIEDGAVVMMGATINIGAIVGEGTMIDM--NATLGGRATTGKNVHVGAGAVLAGVIEP 161 +++ + G + G I G +GEG +I+ T+G + G V V + Sbjct: 204 RSVRQGGMSQLGGIDIGTGTSLGEGIVIEAAGGVTIGAFSELGARVTVVTSSHDHSFRSL 263 Query: 162 P-SASPVVIEDNVLIGANAVILEGVRVGAGAIVAAGAIVTQDVPAGAVVAGTPAKVIKQT 220 P +PV I +IG A+I+ + +G GA++ ++V +DV VV G + Q Sbjct: 264 PWEEAPVHIGSRCVIGEGAIIVGPLSIGDGAVIKPYSVVIRDVLENTVVNG-----VVQL 318 Query: 221 SEVQD 225 E+Q+ Sbjct: 319 MEIQE 323 Lambda K H 0.315 0.132 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 148 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 240 Length of database: 323 Length adjustment: 25 Effective length of query: 215 Effective length of database: 298 Effective search space: 64070 Effective search space used: 64070 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory