Align Homocitrate synthase; EC 2.3.3.14 (uncharacterized)
to candidate Pf1N1B4_847 2-isopropylmalate synthase (EC 2.3.3.13)
Query= curated2:P05345 (381 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_847 Length = 559 Score = 62.4 bits (150), Expect = 3e-14 Identities = 50/154 (32%), Positives = 70/154 (45%), Gaps = 14/154 (9%) Query: 190 IEMHAHNDLGMATANTLAAVSAGATSVNTTVLGLGERAGNAAAWKPSALGLERCLGVETG 249 I +H HND G A T + AGA V + G GER GN AL L GV+ Sbjct: 243 ISLHTHNDRGTGVAATELGLMAGADRVEGCLFGNGERTGNVDL-VTVALNL-YTQGVDPE 300 Query: 250 VHFSALPALCQRVAEAAQRAIDPQQPLVGELVFTHESGVHVAALLRD----------SES 299 + FS + + + V E Q + P+ P VG+LV T SG H A+ + Sbjct: 301 LDFSDIDGVRKVVEECNQIQVHPRHPYVGDLVHTAFSGSHQDAIRKGFAQQQPDALWEVP 360 Query: 300 YQSIAPSLMGRSYRLVL--GKHSGRQAVNGVFDQ 331 Y I P+ +GRSY V+ SG+ + + +Q Sbjct: 361 YLPIDPADIGRSYEAVIRVNSQSGKGGIAYLLEQ 394 Lambda K H 0.319 0.132 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 402 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 381 Length of database: 559 Length adjustment: 33 Effective length of query: 348 Effective length of database: 526 Effective search space: 183048 Effective search space used: 183048 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory