Align arogenate dehydratase (EC 4.2.1.91) (characterized)
to candidate Pf1N1B4_54 Cyclohexadienyl dehydratase (EC 4.2.1.51)(EC 4.2.1.91)
Query= BRENDA::Q01269 (268 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_54 Length = 263 Score = 240 bits (613), Expect = 2e-68 Identities = 120/257 (46%), Positives = 173/257 (67%), Gaps = 2/257 (0%) Query: 3 KSFRHLVQALACLALLASASLQAQESRLDRILESGVLRVATTGDYKPFSYRTEEGGYAGF 62 K+ + + LAL + + S LD +L+ G LRV TTGDYKP++++ E+G Y+G Sbjct: 2 KTIKSTMMLCGLLALASGVQAEQPPSHLDTVLQQGQLRVCTTGDYKPYTFKGEDGEYSGI 61 Query: 63 DVDMAQRLAESLGAKLVVVPTSWPNLMRDFADDRFDIAMSGISINLERQRQAYFSIPYLR 122 D+ MA+ LA+SLG K+ V T+W LM D + DI + GIS+ LERQ++A+FS Sbjct: 62 DIAMARSLADSLGVKVEWVQTTWKTLMPDMLAGKCDIGVGGISVTLERQKKAFFSTTLDV 121 Query: 123 DGKTPITLCSEEARFQTLEQIDQPGVTAIVNPGGTNEKFARANLKKARILVHPDNVTIFQ 182 DGK P+ C +A++QT+EQI+QP V + GGTNE F A L KA++ +H DNVTIFQ Sbjct: 122 DGKIPLVRCENQAQYQTIEQINQPSVRLVEPAGGTNEAFVHAFLPKAQLKLH-DNVTIFQ 180 Query: 183 QIVDGKADLMMTDAIEARLQSRLHPELCAVHPQQPFDFAEKAYLLPRDE-AFKRYVDQWL 241 +++D KAD+M+TDA EA Q +L P LCAV+P Q + EKAYLLPR++ ++K YVDQWL Sbjct: 181 ELLDKKADVMITDASEALYQQKLKPGLCAVNPTQFMQYGEKAYLLPREDISWKLYVDQWL 240 Query: 242 HIAEQSGLLRQRMEHWL 258 H+A+ +G ++ + W+ Sbjct: 241 HLAKVTGNYQKILGQWI 257 Lambda K H 0.322 0.135 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 203 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 268 Length of database: 263 Length adjustment: 25 Effective length of query: 243 Effective length of database: 238 Effective search space: 57834 Effective search space used: 57834 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory