GapMind for Amino acid biosynthesis

 

Alignments for a candidate for proC in Pseudomonas fluorescens FW300-N1B4

Align Pyrroline-5-carboxylate reductase; P5C reductase; P5CR; PCA reductase; EC 1.5.1.2 (characterized)
to candidate Pf1N1B4_2341 Pyrroline-5-carboxylate reductase (EC 1.5.1.2)

Query= SwissProt::P22008
         (273 letters)



>FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2341
          Length = 272

 Score =  378 bits (970), Expect = e-110
 Identities = 195/273 (71%), Positives = 235/273 (86%), Gaps = 1/273 (0%)

Query: 1   MSTPRIAFIGAGNMAASLIGGLRAQGVPAAQIRASDPGAEQRAKIAGEFAIDVVESNAEA 60
           MS  RIAFIGAGNMAASLIGGLRA+G+ AAQIRASDPG E RA+++ E  I+V   NA+A
Sbjct: 1   MSKTRIAFIGAGNMAASLIGGLRAKGLDAAQIRASDPGEETRARVSAEHGIEVFADNADA 60

Query: 61  VADADVVVLSVKPQAMKAVCQALAPALKPEQLIVSIAAGIPCASLEAWLGQPRPVVRCMP 120
           +   DV+VL+VKPQAMKAVC+A+ P+L P QL+VSIAAGI CAS++ WLG  +P+VRCMP
Sbjct: 61  IQGVDVIVLAVKPQAMKAVCEAIRPSLAPNQLVVSIAAGITCASMKKWLGA-QPIVRCMP 119

Query: 121 NTPALLRQGASGLYANAQVSAAQCEQAGQLLSAVGIALWLDDEAQIDAVTAVSGSGPAYF 180
           NTPALLRQG SGL+A ++VSA Q +QA +LLSAVGIALWL++E Q+DAVTAVSGSGPAYF
Sbjct: 120 NTPALLRQGVSGLFATSEVSAEQRQQAEELLSAVGIALWLNEEQQLDAVTAVSGSGPAYF 179

Query: 181 FLLMQAMTDAGEKLGLSRETASRLTLQTALGAAQMALSSEVEPAELRRRVTSPNGTTEAA 240
           FLL++AMT AG KLGL  + A++LT+QTALGAA MA++S+V+ AELRRRVTSP GTTEAA
Sbjct: 180 FLLIEAMTAAGVKLGLPADIAAQLTVQTALGAAHMAVASDVDAAELRRRVTSPAGTTEAA 239

Query: 241 IKSFQANGFEALVEQALNAASQRSAELAEQLGQ 273
           IKSFQA GFEALVE+AL AA+ RSAE+AEQLG+
Sbjct: 240 IKSFQAGGFEALVEKALGAAAHRSAEMAEQLGR 272


Lambda     K      H
   0.315    0.127    0.348 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 278
Number of extensions: 6
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 273
Length of database: 272
Length adjustment: 25
Effective length of query: 248
Effective length of database: 247
Effective search space:    61256
Effective search space used:    61256
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 47 (22.7 bits)

Align candidate Pf1N1B4_2341 (Pyrroline-5-carboxylate reductase (EC 1.5.1.2))
to HMM TIGR00112 (proC: pyrroline-5-carboxylate reductase (EC 1.5.1.2))

Software error:

../bin/blast/fastacmd -i /tmp/list.15384.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.15384.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.