GapMind for Amino acid biosynthesis

 

Alignments for a candidate for cmutase in Pseudomonas fluorescens FW300-N1B4

Align isochorismate lyase (EC 4.2.99.21) (characterized)
to candidate Pf1N1B4_4123 Isochorismate pyruvate-lyase (EC 4.-.-.-)

Query= BRENDA::Q51507
         (101 letters)



>FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4123
          Length = 106

 Score = 90.5 bits (223), Expect = 5e-24
 Identities = 39/91 (42%), Positives = 60/91 (65%)

Query: 4  PEDCTGLADIREAIDRIDLDIVQALGRRMDYVKAASRFKASEAAIPAPERVAAMLPERAR 63
          P +C G+ DIR  ID +D  +++ LG+R  YV AAS+FK S  ++ APER  AML  R  
Sbjct: 9  PAECEGMEDIRREIDALDHAVIKLLGKRFQYVLAASKFKTSATSVRAPERFKAMLATRRE 68

Query: 64 WAEENGLDAPFVEGLFAQIIHWYIAEQIKYW 94
          WAE  GL    +E +++ +++ +IAE++K+W
Sbjct: 69 WAETEGLSPDAIEKMYSDLVNHFIAEEMKHW 99


Lambda     K      H
   0.322    0.135    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 43
Number of extensions: 3
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 101
Length of database: 106
Length adjustment: 11
Effective length of query: 90
Effective length of database: 95
Effective search space:     8550
Effective search space used:     8550
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 40 (20.0 bits)

Align candidate Pf1N1B4_4123 (Isochorismate pyruvate-lyase (EC 4.-.-.-))
to HMM PF01817 (CM_2)

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/PF01817.25.hmm
# target sequence database:        /tmp/gapView.24211.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       CM_2  [M=79]
Accession:   PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                      -----------
    5.2e-22   64.4   0.1    6.4e-22   64.1   0.1    1.1  1  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4123  Isochorismate pyruvate-lyase (EC


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4123  Isochorismate pyruvate-lyase (EC 4.-.-.-)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   64.1   0.1   6.4e-22   6.4e-22       1      78 [.      19      95 ..      19      96 .. 0.96

  Alignments for each domain:
  == domain 1  score: 64.1 bits;  conditional E-value: 6.4e-22
                                           CM_2  1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeaveki 66
                                                   R+eId++D+  ++Ll +R++++ ++ ++K+ +  +v+ peR +++l+ +re+ae +gl+p+a+ek+
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4123 19 RREIDALDHAVIKLLGKRFQYVLAASKFKT-SATSVRAPERFKAMLATRREWAETEGLSPDAIEKM 83
                                                   99***************************5.666******************************** PP

                                           CM_2 67 freiisesralQ 78
                                                   + +++++++a +
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4123 84 YSDLVNHFIAEE 95
                                                   ********9987 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (79 nodes)
Target sequences:                          1  (106 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00
# Mc/sec: 3.05
//
[ok]

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory