Align cysteine synthase (EC 2.5.1.47) (characterized)
to candidate AO353_18020 AO353_18020 cysteine synthase
Query= BRENDA::P0ABK5 (323 letters) >FitnessBrowser__pseudo3_N2E3:AO353_18020 Length = 324 Score = 452 bits (1162), Expect = e-132 Identities = 229/325 (70%), Positives = 271/325 (83%), Gaps = 3/325 (0%) Query: 1 MSKIFEDNSLTIGHTPLVRLNRIG--NGRILAKVESRNPSFSVKCRIGANMIWDAEKRGV 58 MS+IF DN+ +IG+TPLV++NRI ILAK+E RNP +SVKCRIGANMIWDAE G Sbjct: 1 MSRIFADNAHSIGNTPLVQINRIAPRGVTILAKIEGRNPGYSVKCRIGANMIWDAESSGK 60 Query: 59 LKPGVELVEPTSGNTGIALAYVAAARGYKLTLTMPETMSIERRKLLKALGANLVLTEGAK 118 LKPG+ ++EPTSGNTGI LA+VAAARGYKL LTMP +MSIERRK+LKALGA LVLTE AK Sbjct: 61 LKPGMTIIEPTSGNTGIGLAFVAAARGYKLVLTMPASMSIERRKVLKALGAELVLTEPAK 120 Query: 119 GMKGAIQKAEEIVASNPEKYLLLQQFSNPANPEIHEKTTGPEIWEDTDGQVDVFIAGVGT 178 GMKGAI+KA EI+AS+P +Y + QQF NPANP IHEKTTGPEIW DTDG +DV +AGVGT Sbjct: 121 GMKGAIEKAAEILASDPARYFMPQQFENPANPAIHEKTTGPEIWNDTDGAIDVLVAGVGT 180 Query: 179 GGTLTGVSRYIKGTKGKTDLISVAVEPTDSPVIAQALAGEEIKPGPHKIQGIGAGFIPAN 238 GGT+TGVSRYIK T+GK ++SVAVEP SPVI QA+AGEEIKP PHKIQGIGAGF+P N Sbjct: 181 GGTITGVSRYIKNTQGK-PILSVAVEPLVSPVITQAMAGEEIKPSPHKIQGIGAGFVPKN 239 Query: 239 LDLKLVDKVIGITNEEAISTARRLMEEEGILAGISSGAAVAAALKLQEDESFTNKNIVVI 298 LDL +VD+V +++EE+ + A RLM+EEGIL+GIS GAA+A A++L E K IVVI Sbjct: 240 LDLSIVDRVELVSDEESKAMALRLMQEEGILSGISCGAAMAVAVRLAETPEMQGKTIVVI 299 Query: 299 LPSSGERYLSTALFADLFTEKELQQ 323 LP SGERYLS+ LF+DLFTE+ELQQ Sbjct: 300 LPDSGERYLSSMLFSDLFTEQELQQ 324 Lambda K H 0.313 0.133 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 410 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 324 Length adjustment: 28 Effective length of query: 295 Effective length of database: 296 Effective search space: 87320 Effective search space used: 87320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 48 (23.1 bits)
Align candidate AO353_18020 AO353_18020 (cysteine synthase)
to HMM TIGR01139 (cysK: cysteine synthase A (EC 2.5.1.47))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01139.hmm # target sequence database: /tmp/gapView.5851.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01139 [M=298] Accession: TIGR01139 Description: cysK: cysteine synthase A Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-139 450.5 0.8 1.5e-139 450.3 0.8 1.0 1 lcl|FitnessBrowser__pseudo3_N2E3:AO353_18020 AO353_18020 cysteine synthase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo3_N2E3:AO353_18020 AO353_18020 cysteine synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 450.3 0.8 1.5e-139 1.5e-139 3 298 .] 10 313 .. 8 313 .. 0.99 Alignments for each domain: == domain 1 score: 450.3 bits; conditional E-value: 1.5e-139 TIGR01139 3 eliGntPlvrLnlaeeakaevlvkleslnPsssvkdrialamiedaekegllkkgktiveatsGn 67 + iGntPlv++n++++ + +l+k+e +nP++svk+ri+++mi+dae +g+lk+g ti+e+tsGn lcl|FitnessBrowser__pseudo3_N2E3:AO353_18020 10 HSIGNTPLVQINRIAPRGVTILAKIEGRNPGYSVKCRIGANMIWDAESSGKLKPGMTIIEPTSGN 74 78*************************************************************** PP TIGR01139 68 tGialamvaaargykliltmpetmslerrkllkayGaelvLtdgaegmkgaiekaeelveetpnk 132 tGi+la+vaaargykl+ltmp++ms+errk+lka+GaelvLt++a+gmkgaieka e+++++p + lcl|FitnessBrowser__pseudo3_N2E3:AO353_18020 75 TGIGLAFVAAARGYKLVLTMPASMSIERRKVLKALGAELVLTEPAKGMKGAIEKAAEILASDPAR 139 ***************************************************************** PP TIGR01139 133 ylllkqfenpanpeihrkttapeilkdldgkldafvagvGtGGtitGvgevlkekkp.dikvvav 196 y++++qfenpanp+ih+ktt+pei++d+dg++d++vagvGtGGtitGv++++k++++ i +vav lcl|FitnessBrowser__pseudo3_N2E3:AO353_18020 140 YFMPQQFENPANPAIHEKTTGPEIWNDTDGAIDVLVAGVGTGGTITGVSRYIKNTQGkPILSVAV 204 ******************************************************99978****** PP TIGR01139 197 ePaespvlsgg......kpgphkiqGigagfiPkvLdkevidevikvsdeeaietarrlakeeGi 255 eP spv++++ kp phkiqGigagf+Pk+Ld +++d+v vsdee+ ++a rl++eeGi lcl|FitnessBrowser__pseudo3_N2E3:AO353_18020 205 EPLVSPVITQAmageeiKPSPHKIQGIGAGFVPKNLDLSIVDRVELVSDEESKAMALRLMQEEGI 269 **********9999999************************************************ PP TIGR01139 256 lvGissGaavaaalkvakkle.kdkkivvilpdtgerYlstaLf 298 l+Gis Gaa+a a+++a+ +e ++k+ivvilpd+gerYls Lf lcl|FitnessBrowser__pseudo3_N2E3:AO353_18020 270 LSGISCGAAMAVAVRLAETPEmQGKTIVVILPDSGERYLSSMLF 313 *********************9*******************998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (324 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.59 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory