GapMind for Amino acid biosynthesis

 

Aligments for a candidate for leuB in Pseudomonas fluorescens FW300-N2E3

Align 3-isopropylmalate dehydrogenase (EC 1.1.1.85) (characterized)
to candidate AO353_20635 AO353_20635 3-isopropylmalate dehydrogenase

Query= BRENDA::P96197
         (360 letters)



>lcl|FitnessBrowser__pseudo3_N2E3:AO353_20635 AO353_20635
           3-isopropylmalate dehydrogenase
          Length = 360

 Score =  515 bits (1326), Expect = e-151
 Identities = 280/372 (75%), Positives = 303/372 (81%), Gaps = 24/372 (6%)

Query: 1   MSKQILVLPGDGIGPEIMAEAVKVLQLANEKYQLGFVLGYDELGGAAVDKYGVPLADETL 60
           MSKQIL+LPGDGIGPEIM EAVKVL+LAN+K+ L F L +D +GGAA+DK+GVPLADETL
Sbjct: 1   MSKQILILPGDGIGPEIMTEAVKVLELANDKFALDFELSHDVIGGAAIDKHGVPLADETL 60

Query: 61  ERARR------------RCHPARRRRRSEMGRHRPGHPPGARPAENPFATGPVRQPAPGV 108
            RAR             +     R  R E G  +     G          G +R   P +
Sbjct: 61  ARARAADAVLLGAVGGPKWDTIERDIRPERGLLKIRAQLGL--------FGNLR---PAI 109

Query: 109 LYPQLAEASTLRPEVVAGLDILIVRELTGGIYFGAPRESRLLANGERMAYDTLPYSESEI 168
           LYPQLAEAS+L+ E+VAGLDILIVRELTGGIYFGAPR  R L NGER AYDTLPYSESEI
Sbjct: 110 LYPQLAEASSLKAEIVAGLDILIVRELTGGIYFGAPRGVRELENGERQAYDTLPYSESEI 169

Query: 169 RRIAKVGFDMARVRGKKLCSVDKANVLASSQLWRAVVEEVAKDYPDVVLSHMYVDNAAMQ 228
           RRIA+VGFDMARVRGKKLCSVDKANVLASSQLWR +VE+VAKDYPDV LSHMYVDNAAMQ
Sbjct: 170 RRIARVGFDMARVRGKKLCSVDKANVLASSQLWREIVEQVAKDYPDVELSHMYVDNAAMQ 229

Query: 229 LVRAPKQFDVIVTDNMFGDILSDEASMLTGSIGMLPSASLDADNKGMYEPCHGSRRPDIA 288
           LVRAPKQFDVIVTDN+FGDILSDEASMLTGSIGMLPSASLDA+NKGMYEPCHGS  PDIA
Sbjct: 230 LVRAPKQFDVIVTDNLFGDILSDEASMLTGSIGMLPSASLDANNKGMYEPCHGS-APDIA 288

Query: 289 GKGIANPLATILSVSMMLRYSFGQVEAANAIEQAVSKVLDQGLRTGDIWSEGCRKVGTAE 348
           GKGIANPLATILSVSMMLRYSF Q+ AA+AIE+AVS VLDQGLRTGDIWS GC KVGT E
Sbjct: 289 GKGIANPLATILSVSMMLRYSFNQLVAADAIEKAVSLVLDQGLRTGDIWSPGCVKVGTQE 348

Query: 349 MGDAVVAALATL 360
           MGDAVVAAL  L
Sbjct: 349 MGDAVVAALRNL 360


Lambda     K      H
   0.318    0.135    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 468
Number of extensions: 5
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 360
Length of database: 360
Length adjustment: 29
Effective length of query: 331
Effective length of database: 331
Effective search space:   109561
Effective search space used:   109561
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 49 (23.5 bits)

Align candidate AO353_20635 AO353_20635 (3-isopropylmalate dehydrogenase)
to HMM TIGR00169 (leuB: 3-isopropylmalate dehydrogenase (EC 1.1.1.85))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00169.hmm
# target sequence database:        /tmp/gapView.4203.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00169  [M=349]
Accession:   TIGR00169
Description: leuB: 3-isopropylmalate dehydrogenase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                     -----------
   3.6e-164  531.8   0.0   4.1e-164  531.6   0.0    1.0  1  lcl|FitnessBrowser__pseudo3_N2E3:AO353_20635  AO353_20635 3-isopropylmalate de


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo3_N2E3:AO353_20635  AO353_20635 3-isopropylmalate dehydrogenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  531.6   0.0  4.1e-164  4.1e-164       1     348 [.       4     352 ..       4     353 .. 0.99

  Alignments for each domain:
  == domain 1  score: 531.6 bits;  conditional E-value: 4.1e-164
                                     TIGR00169   1 kiavLpGDgiGpevvaealkvLkaveerfelklefeealiGGaaidatgePlpeetlkackeada 65 
                                                   +i +LpGDgiGpe+++ea+kvL+  +++f+l++e ++  iGGaaid++g Pl++etl+ +++ada
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_20635   4 QILILPGDGIGPEIMTEAVKVLELANDKFALDFELSHDVIGGAAIDKHGVPLADETLARARAADA 68 
                                                   589************************************************************** PP

                                     TIGR00169  66 vLlgavGGpkWdnlprdvrPekgLLklrkeldlfanLrPaklfksLeklsplkeeivkgvDlvvv 130
                                                   vLlgavGGpkWd+  rd+rPe+gLLk+r +l+lf nLrPa l+++L ++s+lk+eiv g+D+++v
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_20635  69 VLLGAVGGPKWDTIERDIRPERGLLKIRAQLGLFGNLRPAILYPQLAEASSLKAEIVAGLDILIV 133
                                                   ***************************************************************** PP

                                     TIGR00169 131 reLtgGiYfGepkereeaee.ekkaldtekYtkeeieriarvafelarkrrkkvtsvDkanvLes 194
                                                   reLtgGiYfG p++ +e e+ e++a+dt  Y+++ei+riarv+f +ar r kk++svDkanvL+s
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_20635 134 RELTGGIYFGAPRGVRELENgERQAYDTLPYSESEIRRIARVGFDMARVRGKKLCSVDKANVLAS 198
                                                   *****************9999******************************************** PP

                                     TIGR00169 195 srlWrktveeiakeyPdvelehlyiDnaamqLvksPeqldvvvtsnlfGDilsDeasvitGslGl 259
                                                   s+lWr++ve++ak+yPdvel+h+y+DnaamqLv++P+q+dv+vt+nlfGDilsDeas++tGs+G+
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_20635 199 SQLWREIVEQVAKDYPDVELSHMYVDNAAMQLVRAPKQFDVIVTDNLFGDILSDEASMLTGSIGM 263
                                                   ***************************************************************** PP

                                     TIGR00169 260 LPsaslsskglalfepvhgsapdiagkgianpiaailsaalllryslnleeaaeaieaavkkvle 324
                                                   LPsasl  + ++++ep hgsapdiagkgianp+a+ils++++lrys+n+  aa+aie+av+ vl+
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_20635 264 LPSASLDANNKGMYEPCHGSAPDIAGKGIANPLATILSVSMMLRYSFNQLVAADAIEKAVSLVLD 328
                                                   ***************************************************************** PP

                                     TIGR00169 325 egkrtedlaseattavstkeveee 348
                                                   +g rt d+ s ++ +v+t+e+++ 
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_20635 329 QGLRTGDIWSPGCVKVGTQEMGDA 352
                                                   *********************986 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (349 nodes)
Target sequences:                          1  (360 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 7.04
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory