Align 3-isopropylmalate dehydrogenase (EC 1.1.1.85) (characterized)
to candidate AO353_20635 AO353_20635 3-isopropylmalate dehydrogenase
Query= BRENDA::P96197 (360 letters) >FitnessBrowser__pseudo3_N2E3:AO353_20635 Length = 360 Score = 515 bits (1326), Expect = e-151 Identities = 280/372 (75%), Positives = 303/372 (81%), Gaps = 24/372 (6%) Query: 1 MSKQILVLPGDGIGPEIMAEAVKVLQLANEKYQLGFVLGYDELGGAAVDKYGVPLADETL 60 MSKQIL+LPGDGIGPEIM EAVKVL+LAN+K+ L F L +D +GGAA+DK+GVPLADETL Sbjct: 1 MSKQILILPGDGIGPEIMTEAVKVLELANDKFALDFELSHDVIGGAAIDKHGVPLADETL 60 Query: 61 ERARR------------RCHPARRRRRSEMGRHRPGHPPGARPAENPFATGPVRQPAPGV 108 RAR + R R E G + G G +R P + Sbjct: 61 ARARAADAVLLGAVGGPKWDTIERDIRPERGLLKIRAQLGL--------FGNLR---PAI 109 Query: 109 LYPQLAEASTLRPEVVAGLDILIVRELTGGIYFGAPRESRLLANGERMAYDTLPYSESEI 168 LYPQLAEAS+L+ E+VAGLDILIVRELTGGIYFGAPR R L NGER AYDTLPYSESEI Sbjct: 110 LYPQLAEASSLKAEIVAGLDILIVRELTGGIYFGAPRGVRELENGERQAYDTLPYSESEI 169 Query: 169 RRIAKVGFDMARVRGKKLCSVDKANVLASSQLWRAVVEEVAKDYPDVVLSHMYVDNAAMQ 228 RRIA+VGFDMARVRGKKLCSVDKANVLASSQLWR +VE+VAKDYPDV LSHMYVDNAAMQ Sbjct: 170 RRIARVGFDMARVRGKKLCSVDKANVLASSQLWREIVEQVAKDYPDVELSHMYVDNAAMQ 229 Query: 229 LVRAPKQFDVIVTDNMFGDILSDEASMLTGSIGMLPSASLDADNKGMYEPCHGSRRPDIA 288 LVRAPKQFDVIVTDN+FGDILSDEASMLTGSIGMLPSASLDA+NKGMYEPCHGS PDIA Sbjct: 230 LVRAPKQFDVIVTDNLFGDILSDEASMLTGSIGMLPSASLDANNKGMYEPCHGS-APDIA 288 Query: 289 GKGIANPLATILSVSMMLRYSFGQVEAANAIEQAVSKVLDQGLRTGDIWSEGCRKVGTAE 348 GKGIANPLATILSVSMMLRYSF Q+ AA+AIE+AVS VLDQGLRTGDIWS GC KVGT E Sbjct: 289 GKGIANPLATILSVSMMLRYSFNQLVAADAIEKAVSLVLDQGLRTGDIWSPGCVKVGTQE 348 Query: 349 MGDAVVAALATL 360 MGDAVVAAL L Sbjct: 349 MGDAVVAALRNL 360 Lambda K H 0.318 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 468 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 360 Length of database: 360 Length adjustment: 29 Effective length of query: 331 Effective length of database: 331 Effective search space: 109561 Effective search space used: 109561 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate AO353_20635 AO353_20635 (3-isopropylmalate dehydrogenase)
to HMM TIGR00169 (leuB: 3-isopropylmalate dehydrogenase (EC 1.1.1.85))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00169.hmm # target sequence database: /tmp/gapView.953.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00169 [M=349] Accession: TIGR00169 Description: leuB: 3-isopropylmalate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-164 531.8 0.0 4.1e-164 531.6 0.0 1.0 1 lcl|FitnessBrowser__pseudo3_N2E3:AO353_20635 AO353_20635 3-isopropylmalate de Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo3_N2E3:AO353_20635 AO353_20635 3-isopropylmalate dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 531.6 0.0 4.1e-164 4.1e-164 1 348 [. 4 352 .. 4 353 .. 0.99 Alignments for each domain: == domain 1 score: 531.6 bits; conditional E-value: 4.1e-164 TIGR00169 1 kiavLpGDgiGpevvaealkvLkaveerfelklefeealiGGaaidatgePlpeetlkackeada 65 +i +LpGDgiGpe+++ea+kvL+ +++f+l++e ++ iGGaaid++g Pl++etl+ +++ada lcl|FitnessBrowser__pseudo3_N2E3:AO353_20635 4 QILILPGDGIGPEIMTEAVKVLELANDKFALDFELSHDVIGGAAIDKHGVPLADETLARARAADA 68 589************************************************************** PP TIGR00169 66 vLlgavGGpkWdnlprdvrPekgLLklrkeldlfanLrPaklfksLeklsplkeeivkgvDlvvv 130 vLlgavGGpkWd+ rd+rPe+gLLk+r +l+lf nLrPa l+++L ++s+lk+eiv g+D+++v lcl|FitnessBrowser__pseudo3_N2E3:AO353_20635 69 VLLGAVGGPKWDTIERDIRPERGLLKIRAQLGLFGNLRPAILYPQLAEASSLKAEIVAGLDILIV 133 ***************************************************************** PP TIGR00169 131 reLtgGiYfGepkereeaee.ekkaldtekYtkeeieriarvafelarkrrkkvtsvDkanvLes 194 reLtgGiYfG p++ +e e+ e++a+dt Y+++ei+riarv+f +ar r kk++svDkanvL+s lcl|FitnessBrowser__pseudo3_N2E3:AO353_20635 134 RELTGGIYFGAPRGVRELENgERQAYDTLPYSESEIRRIARVGFDMARVRGKKLCSVDKANVLAS 198 *****************9999******************************************** PP TIGR00169 195 srlWrktveeiakeyPdvelehlyiDnaamqLvksPeqldvvvtsnlfGDilsDeasvitGslGl 259 s+lWr++ve++ak+yPdvel+h+y+DnaamqLv++P+q+dv+vt+nlfGDilsDeas++tGs+G+ lcl|FitnessBrowser__pseudo3_N2E3:AO353_20635 199 SQLWREIVEQVAKDYPDVELSHMYVDNAAMQLVRAPKQFDVIVTDNLFGDILSDEASMLTGSIGM 263 ***************************************************************** PP TIGR00169 260 LPsaslsskglalfepvhgsapdiagkgianpiaailsaalllryslnleeaaeaieaavkkvle 324 LPsasl + ++++ep hgsapdiagkgianp+a+ils++++lrys+n+ aa+aie+av+ vl+ lcl|FitnessBrowser__pseudo3_N2E3:AO353_20635 264 LPSASLDANNKGMYEPCHGSAPDIAGKGIANPLATILSVSMMLRYSFNQLVAADAIEKAVSLVLD 328 ***************************************************************** PP TIGR00169 325 egkrtedlaseattavstkeveee 348 +g rt d+ s ++ +v+t+e+++ lcl|FitnessBrowser__pseudo3_N2E3:AO353_20635 329 QGLRTGDIWSPGCVKVGTQEMGDA 352 *********************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (360 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.67 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory