GapMind for Amino acid biosynthesis

 

Aligments for a candidate for leuC in Pseudomonas fluorescens FW300-N2E3

Align 3-isopropylmalate dehydratase large subunit 2; EC 4.2.1.33; Alpha-IPM isomerase 2; IPMI 2; Isopropylmalate isomerase 2 (uncharacterized)
to candidate AO353_00890 AO353_00890 Fe/S-dependent 2-methylisocitrate dehydratase AcnD

Query= curated2:Q9WZ24
         (417 letters)



>lcl|FitnessBrowser__pseudo3_N2E3:AO353_00890 AO353_00890
           Fe/S-dependent 2-methylisocitrate dehydratase AcnD
          Length = 864

 Score =  121 bits (303), Expect = 9e-32
 Identities = 110/343 (32%), Positives = 149/343 (43%), Gaps = 46/343 (13%)

Query: 114 DLVVGADSHTCTYGALGAFATGVGSTDIAGFYLIGKVWFRVPESIKVTLRGKFKDLVTAK 173
           D  VG DSHT    ALG  A GVG  +     L    W R+PES+ V L GK +  +TA 
Sbjct: 194 DTCVGTDSHTPHVDALGVIAIGVGGLEAESVMLGRASWMRLPESVGVELTGKLQPGITAT 253

Query: 174 DLVLKLISILGVDGANYKAIEFSGPGVKEISMDGRFTISNMAIEAGGKTGLFPVDEITIA 233
           D+VL L   L         +EF G G   +++  R TISNMA E G    +F +D+ TI 
Sbjct: 254 DMVLALTEFLRKQKVVGAWLEFFGEGASALTLGDRATISNMAPEYGATAAMFYIDQQTID 313

Query: 234 YERERGIEVEEMYPDED--------------AKYVREVEMDLSELEPQVAYPFLPSNAKD 279
           Y +  G E E++   E+              A+Y R +  DLS +   +A P  P     
Sbjct: 314 YLKLTGREDEQVQLVENYAKTTGLWADSLKGAQYERGLTFDLSSVVRNMAGPSNPHARVA 373

Query: 280 VSEAEKERIK--------------IDQAVIGSCTNGRIEDLRLAAQILK------GRTVS 319
            S+   + I               +  A I SCTN       +AA +L       G T  
Sbjct: 374 TSDLAAQGISGQWDDVPGQMPDGAVIIAAITSCTNTSNPRNVIAAGLLARNANKLGLTRK 433

Query: 320 PDVRCIIIPGSQKVYKQALKEGLIDIFIDAGCAVSTPTCGPCLG--GHMGVLAEGEV--- 374
           P V+  + PGS+ V     + GL       G  V    C  C G  G +  + + E+   
Sbjct: 434 PWVKSSLAPGSKTVALYLDEAGLTSELEQLGFGVVAFACTTCNGMSGALDPVIQQEIIDR 493

Query: 375 -----AISTTNRNFVGRMGHPNSK-VFLASPAVAAASAIKGYI 411
                A+ + NRNF GR+ HP +K  FLASP +  A AI G I
Sbjct: 494 DLYATAVLSGNRNFDGRI-HPYAKQAFLASPPLVVAYAIAGTI 535


Lambda     K      H
   0.318    0.138    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 720
Number of extensions: 41
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 417
Length of database: 864
Length adjustment: 37
Effective length of query: 380
Effective length of database: 827
Effective search space:   314260
Effective search space used:   314260
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory