Align dihydrodipicolinate reductase; EC 1.3.1.26 (characterized)
to candidate AO353_05640 AO353_05640 4-hydroxy-tetrahydrodipicolinate reductase
Query= CharProtDB::CH_002128 (273 letters) >FitnessBrowser__pseudo3_N2E3:AO353_05640 Length = 268 Score = 331 bits (849), Expect = 9e-96 Identities = 173/265 (65%), Positives = 205/265 (77%), Gaps = 1/265 (0%) Query: 7 RVAIAGAGGRMGRQLIQAALALEGVQ-LGAALEREGSSLLGSDAGELAGAGKTGVTVQSS 65 R+A+ GA GRMG+ LI+A + L AA+ R GS+L+G DAGELA G+ GV + + Sbjct: 3 RIAVMGAAGRMGKILIEAVQQRAPLTGLTAAIVRPGSTLIGVDAGELAALGRIGVPLSGN 62 Query: 66 LDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAADIAIVF 125 L+ V +FDV IDFT PE L +LAFCR+ GK MVIGTTG D A KQ + +A DI IVF Sbjct: 63 LEMVAAEFDVLIDFTLPEVMLKNLAFCRKVGKAMVIGTTGLDAAQKQLLAEAGKDIPIVF 122 Query: 126 AANFSVGVNVMLKLLEKAAKVMGDYTDIEIIEAHHRHKVDAPSGTALAMGEAIAHALDKD 185 AANFSVGVN+ LKLL+ AA+V+GD DIEIIEAHHR+K+DAPSGTAL MGE IA ALD+D Sbjct: 123 AANFSVGVNLSLKLLDMAARVLGDDADIEIIEAHHRNKIDAPSGTALRMGEVIASALDRD 182 Query: 186 LKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKASSRMTFAN 245 L+ AVY REGHTG R TIGFATVR GD+VG+HT +FA GERLEITHKASSRMTFA Sbjct: 183 LQKVAVYGREGHTGVRERETIGFATVRGGDVVGDHTVLFACEGERLEITHKASSRMTFAK 242 Query: 246 GAVRSALWLSGKESGLFDMRDVLDL 270 GAVR+ALWL G+E GL+DM+DVLDL Sbjct: 243 GAVRAALWLDGREPGLYDMQDVLDL 267 Lambda K H 0.319 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 275 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 268 Length adjustment: 25 Effective length of query: 248 Effective length of database: 243 Effective search space: 60264 Effective search space used: 60264 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate AO353_05640 AO353_05640 (4-hydroxy-tetrahydrodipicolinate reductase)
to HMM TIGR00036 (dapB: 4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00036.hmm # target sequence database: /tmp/gapView.16174.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00036 [M=270] Accession: TIGR00036 Description: dapB: 4-hydroxy-tetrahydrodipicolinate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-102 328.2 1.4 2.4e-102 328.1 1.4 1.0 1 lcl|FitnessBrowser__pseudo3_N2E3:AO353_05640 AO353_05640 4-hydroxy-tetrahydro Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo3_N2E3:AO353_05640 AO353_05640 4-hydroxy-tetrahydrodipicolinate reductase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 328.1 1.4 2.4e-102 2.4e-102 3 270 .] 3 266 .. 1 266 [. 0.98 Alignments for each domain: == domain 1 score: 328.1 bits; conditional E-value: 2.4e-102 TIGR00036 3 kvavaGaaGrmGrevikavkea.edlelvaalerkgsskqgkDiGelagigkvgvpveddleavk 66 ++av GaaGrmG+ +i+av++ + l+aa+ r+gs + g D+Gela +g++gvp++ +le+v lcl|FitnessBrowser__pseudo3_N2E3:AO353_05640 3 RIAVMGAAGRMGKILIEAVQQRaPLTGLTAAIVRPGSTLIGVDAGELAALGRIGVPLSGNLEMV- 66 89******************9945567***********************************88. PP TIGR00036 67 vlaekkadvliDfttpeavlenvkialekgvrlVvGTTGfseedlkelkdlaekkgvalviapNf 131 ++dvliDft+pe +l+n++++ + g+ +V+GTTG++ ++++ l+++ ++ +++v+a+Nf lcl|FitnessBrowser__pseudo3_N2E3:AO353_05640 67 ---AAEFDVLIDFTLPEVMLKNLAFCRKVGKAMVIGTTGLDAAQKQLLAEAGKD--IPIVFAANF 126 ...899*********************************************999..********* PP TIGR00036 132 aiGvnlllkllekaakvledv.DiEiiElHHrhKkDaPSGTAlklaeiiakargkdlkeaaveer 195 ++Gvnl lkll +aa+vl+d DiEiiE+HHr+K DaPSGTAl+++e+ia a ++dl+++av++r lcl|FitnessBrowser__pseudo3_N2E3:AO353_05640 127 SVGVNLSLKLLDMAARVLGDDaDIEIIEAHHRNKIDAPSGTALRMGEVIASALDRDLQKVAVYGR 191 ******************8766******************************************* PP TIGR00036 196 egltGerkkeeiGiaavRggdvvgehtvlFasdGerleitHkassRaafakGvvrairwledkee 260 eg+tG r++e+iG+a+vRggdvvg+htvlFa +GerleitHkassR++fakG+vra+ wl e lcl|FitnessBrowser__pseudo3_N2E3:AO353_05640 192 EGHTGVRERETIGFATVRGGDVVGDHTVLFACEGERLEITHKASSRMTFAKGAVRAALWLDGREP 256 ***************************************************************** PP TIGR00036 261 kvydledvld 270 ++yd++dvld lcl|FitnessBrowser__pseudo3_N2E3:AO353_05640 257 GLYDMQDVLD 266 ********97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (268 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 10.43 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory