GapMind for Amino acid biosynthesis

 

Aligments for a candidate for dapC in Pseudomonas fluorescens FW300-N2E3

Align phosphoserine aminotransferase; EC 2.6.1.52 (characterized)
to candidate AO353_10515 AO353_10515 3-phosphoserine/phosphohydroxythreonine aminotransferase

Query= CharProtDB::CH_002572
         (362 letters)



>lcl|FitnessBrowser__pseudo3_N2E3:AO353_10515 AO353_10515
           3-phosphoserine/phosphohydroxythreonine aminotransferase
          Length = 360

 Score =  362 bits (929), Expect = e-105
 Identities = 187/363 (51%), Positives = 247/363 (68%), Gaps = 4/363 (1%)

Query: 1   MAQIFNFSSGPAMLPAEVLKQAQQELRDWNGLGTSVMEVSHRGKEFIQVAEEAEKDFRDL 60
           MA+  NFS+GP  LP EVL QA +E  D+ G G SVME+SHR + F++VA + E+D RD+
Sbjct: 1   MARSHNFSAGPTALPMEVLTQAHEEFFDFAGTGMSVMEISHRCEVFMEVAYQTERDLRDI 60

Query: 61  LNVPSNYKVLFCHGGGRGQFAAVPLNILGDKTTADYVDAGYWAASAIKEAKKYCTPNVFD 120
           L VPS YKVLF  GG   QFA VP+N+LG+K TADY+  G W+  AI+ A++YC   +  
Sbjct: 61  LQVPSEYKVLFLQGGASLQFAQVPMNLLGNKRTADYLHTGLWSGKAIEAARRYCDVRIV- 119

Query: 121 AKVTVDGLRAVKPMREWQLSDNAAYMHYCPNETIDGIAIDETPDFGADVVVAADFSSTIL 180
           A     G   +  + +W L+ NAAY+HY  NET+ G+   + PD  A +V   D  S++L
Sbjct: 120 ASGKESGFDRIPDVSDWNLNPNAAYLHYTENETVHGVQFVDAPDGLAPLV--CDACSSLL 177

Query: 181 SRPIDVSRYGVIYAGAQKNIGPAGLTIVIVREDLLGKANIACPSILDYSILNDNGSMFNT 240
           S+PIDV+++G++YA AQKN+G AGLT+VI+   LL  A    P IL+Y+ + D  SM NT
Sbjct: 178 SKPIDVAKHGLVYAAAQKNMGVAGLTVVIIDPALLDGAQAFTPDILNYARITDAQSMLNT 237

Query: 241 PPTFAWYLSGLVFKWLKANGGVAEMDKINQQKAELLYGVIDNSD-FYRNDVAKANRSRMN 299
           P TF WYL+GL  KW+K  GG+  + ++NQ KAELLY  ID+SD FYRN V    RS  N
Sbjct: 238 PATFPWYLTGLTLKWIKRRGGLEALHRLNQTKAELLYRTIDDSDGFYRNSVRAPFRSINN 297

Query: 300 VPFQLADSALDKLFLEESFAAGLHALKGHRVVGGMRASIYNAMPLEGVKALTDFMVEFER 359
           VPF LAD+AL+K F++ +  AGL+ LKGH  VGG+RAS+YNA+ LE V+ALTDFM  F R
Sbjct: 298 VPFVLADAALEKTFVQLAEQAGLNGLKGHASVGGIRASLYNAVTLEAVEALTDFMKGFVR 357

Query: 360 RHG 362
            HG
Sbjct: 358 VHG 360


Lambda     K      H
   0.319    0.136    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 380
Number of extensions: 18
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 362
Length of database: 360
Length adjustment: 29
Effective length of query: 333
Effective length of database: 331
Effective search space:   110223
Effective search space used:   110223
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

Align candidate AO353_10515 AO353_10515 (3-phosphoserine/phosphohydroxythreonine aminotransferase)
to HMM TIGR01364 (serC: phosphoserine transaminase (EC 2.6.1.52))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR01364.hmm
# target sequence database:        /tmp/gapView.13143.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01364  [M=358]
Accession:   TIGR01364
Description: serC_1: phosphoserine transaminase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                     -----------
   7.2e-147  474.9   0.0   8.1e-147  474.7   0.0    1.0  1  lcl|FitnessBrowser__pseudo3_N2E3:AO353_10515  AO353_10515 3-phosphoserine/phos


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo3_N2E3:AO353_10515  AO353_10515 3-phosphoserine/phosphohydroxythreonine aminotransferase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  474.7   0.0  8.1e-147  8.1e-147       2     357 ..       5     358 ..       4     359 .. 0.99

  Alignments for each domain:
  == domain 1  score: 474.7 bits;  conditional E-value: 8.1e-147
                                     TIGR01364   2 vnFsaGPaalpeevlekaqkelldfnglglsvmeisHRskefekvveeaesdlreLlnipdnyev 66 
                                                   +nFsaGP+alp evl++a++e++df g+g+svmeisHR + f++v+ ++e+dlr++l++p++y+v
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_10515   5 HNFSAGPTALPMEVLTQAHEEFFDFAGTGMSVMEISHRCEVFMEVAYQTERDLRDILQVPSEYKV 69 
                                                   7**************************************************************** PP

                                     TIGR01364  67 lflqGGattqfaavplnllkekkvadyivtGawskkalkeakkltkevkvvaseeekkyskipde 131
                                                   lflqGGa+ qfa+vp+nll +k++ady+ tG ws ka++ a+++++ v++vas +e+ +++ipd 
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_10515  70 LFLQGGASLQFAQVPMNLLGNKRTADYLHTGLWSGKAIEAARRYCD-VRIVASGKESGFDRIPDV 133
                                                   *********************************************9.****************** PP

                                     TIGR01364 132 eelelkedaayvylcanetieGvefkelpevkkaplvaDlssdilsrkidvskygliyaGaqKni 196
                                                   ++++l+++aay+++++net++Gv+f ++p    aplv+D  s++ls++idv+k+gl+ya aqKn+
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_10515 134 SDWNLNPNAAYLHYTENETVHGVQFVDAP-DGLAPLVCDACSSLLSKPIDVAKHGLVYAAAQKNM 197
                                                   *****************************.6789******************************* PP

                                     TIGR01364 197 GpaGvtvvivrkdllerakkelpsvldYkilaendslyntpptfaiyvlglvlkwlkekGGvkkl 261
                                                   G+aG+tvvi+   ll+ a++ +p++l+Y+ +++ +s++ntp+tf +y++gl+lkw+k++GG+++l
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_10515 198 GVAGLTVVIIDPALLDGAQAFTPDILNYARITDAQSMLNTPATFPWYLTGLTLKWIKRRGGLEAL 262
                                                   ***************************************************************** PP

                                     TIGR01364 262 ekknqeKakllYeaidesegfyknkvekkaRslmnvvFtlkkeelekeFlkeaeekglvslkGhr 326
                                                   ++ nq+Ka+llY +id+s+gfy+n+v++  Rs+ nv+F l+++ lek+F++ ae++gl +lkGh 
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_10515 263 HRLNQTKAELLYRTIDDSDGFYRNSVRAPFRSINNVPFVLADAALEKTFVQLAEQAGLNGLKGHA 327
                                                   ***************************************************************** PP

                                     TIGR01364 327 svGGiRasiYnalpleevqaLvdfmkeFekk 357
                                                   svGGiRas+Yna++le+v+aL dfmk F + 
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_10515 328 SVGGIRASLYNAVTLEAVEALTDFMKGFVRV 358
                                                   ***************************9875 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (358 nodes)
Target sequences:                          1  (360 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 8.64
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory