Align alanine racemase (EC 5.1.1.1) (characterized)
to candidate AO353_24330 AO353_24330 cystathionine beta-lyase
Query= BRENDA::P06721 (395 letters) >FitnessBrowser__pseudo3_N2E3:AO353_24330 Length = 389 Score = 303 bits (776), Expect = 6e-87 Identities = 158/390 (40%), Positives = 231/390 (59%), Gaps = 11/390 (2%) Query: 4 KKLDTQLVNAGRSKKYTLGAVNSVIQRASSLVFDSVEAKKHATRNRANGELFYGRRGTLT 63 K + T L +A G VN+ + R S++ F + E+ + + YGR + Sbjct: 5 KNVQTLLAHASIEPDQHHGFVNTPVYRGSTVAFPTCESMREGRQKYT-----YGRWNNPS 59 Query: 64 HFSLQQAMCELEGGAGCVLFPCGAAAVANSILAFIEQGDHVLMTNTAYEPSQDFCSKILS 123 +L QA+ +LEG G VL P G +A +IL+ + GDH+L+ + Y P + FC ++ Sbjct: 60 TEALTQALQQLEGAEGTVLCPSGLSACTTAILSVVGAGDHLLIADNVYSPIRAFCEQVGQ 119 Query: 124 KLGVTTSWFDPLIGADIVKHLQPNTKIVFLESPGSITMEVHDVPAIVAAVRSVVPDAIIM 183 +LG+ +++DP IGA IV L+PNTK ++ ESPGS+T+E+ D+PAI D +++ Sbjct: 120 RLGIEVTFYDPTIGAGIVDFLKPNTKAIYTESPGSLTLEIQDIPAIAKVAHE--HDILVI 177 Query: 184 IDNTWAAGVLFKALDFGIDVSIQAATKYLVGHSDAMIGTAVCNARCWEQLRENAYLMGQM 243 DNTW + F +L+ G+D+SI AATKY+VGHSDA++GT + R W+ L+ + MG Sbjct: 178 TDNTWGTPLYFPSLELGVDLSIMAATKYIVGHSDAVLGTVSASKRAWDSLKRFHFNMGLF 237 Query: 244 VDADTAYITSRGLRTLGVRLRQHHESSLKVAEWLAEHPQVARVNHPALPGSKGHEFWKRD 303 D + RG+RTL VRL +H++++ VA+WL +V V +PAL H+ WKRD Sbjct: 238 ASPDDVTLALRGMRTLDVRLERHYKNATTVAKWLETREEVEAVYYPALESHPQHQLWKRD 297 Query: 304 FTGSSGLFSFVLKKKLNNEELANYLDNFSLFSMAYSWGGYESLILANQPEHIAAIRPQGE 363 F G+SGL SFV K A LD+ SLFS+ YSWGG+ESL + P+ +R Sbjct: 298 FKGASGLLSFVTKPSTQAAADA-LLDSLSLFSIGYSWGGFESLAMIADPK---PVRSATS 353 Query: 364 IDFSGTLIRLHIGLEDVDDLIADLDAGFAR 393 + G L+RLHIGLED DLI DL+ GFA+ Sbjct: 354 WEIDGHLVRLHIGLEDPSDLIEDLEQGFAK 383 Lambda K H 0.321 0.135 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 399 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 389 Length adjustment: 31 Effective length of query: 364 Effective length of database: 358 Effective search space: 130312 Effective search space used: 130312 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory