Align Homoserine O-acetyltransferase; HAT; Homoserine transacetylase; HTA; EC 2.3.1.31 (characterized)
to candidate AO353_08180 AO353_08180 homoserine O-acetyltransferase
Query= SwissProt::D7E9E0 (489 letters) >FitnessBrowser__pseudo3_N2E3:AO353_08180 Length = 379 Score = 374 bits (960), Expect = e-108 Identities = 189/368 (51%), Positives = 257/368 (69%), Gaps = 6/368 (1%) Query: 5 SIGNVETKYYQIPEELVLESGKKISDVTLAYETYGTLNWDKSNAILVCHALTGDAHAAGW 64 S+G V + E L L G+ + L YETYGTLN SNA+L+CHAL+G HAAG+ Sbjct: 9 SVGLVTPQVAHFSEPLALACGRSLPAYDLIYETYGTLNATASNAVLICHALSGHHHAAGY 68 Query: 65 HEG-DRKPGWWDIIIGPGKALDTRKYFIICSNVIGGCKGSTGPSSINPDTGESYGLDFPV 123 H DRKPGWWD IGPGK +DT K+F++ N +GGC GSTGPSS NPDTG+ +G DFPV Sbjct: 69 HSTEDRKPGWWDSCIGPGKPIDTNKFFVVSLNNLGGCNGSTGPSSTNPDTGKPFGADFPV 128 Query: 124 VTIKDMVNAQKKLIDYLGISKLLAVIGGSMGGLQVLQWSVSYPDMVKKAIPIATAGYSTP 183 +T++D V++Q +L D +GI++ AVIGGS+GG+Q +QWS++YPD ++ + IA+A + Sbjct: 129 LTVEDWVHSQARLADRIGINQWAAVIGGSLGGMQAIQWSITYPDRIRHCLAIASAPKLSA 188 Query: 184 QQIAFNEVGRIAIVSDPNWNSGNYY-GEKEPTHGLALARMIGHITYLSDDSMHQKFGRRL 242 Q IAFNEV R AI++DP+++ G++ P GL LARM+GHITYLSDDSM +KFGR L Sbjct: 189 QNIAFNEVARQAILTDPDFHGGSFQEAGVIPKRGLMLARMVGHITYLSDDSMGEKFGRGL 248 Query: 243 Q-DKNEYEFDFSREFEVESYLHYQGLTFTERFDANSYLYLTKAIDYFDLTEN--NSLAEG 299 + +K Y+F S EF+VESYL YQG F+ RFDAN+YL +TKA+DYFD N ++LA+ Sbjct: 249 KSEKLNYDF-HSVEFQVESYLRYQGEEFSGRFDANTYLLMTKALDYFDPAANFDDNLAKT 307 Query: 300 LKNVEAKFLVISFTSDWLYPPYQLREIVMALSANNADVTYREIESNYGHDSFLLESGQLN 359 +AKF V+SFT+DW + P + RE+V AL A DV Y EI++ GHD+FL+ + Sbjct: 308 FAGAKAKFCVMSFTTDWRFSPARSRELVDALMAAKKDVCYLEIDAPQGHDAFLIPIPRYL 367 Query: 360 YVLNNFLS 367 N+++ Sbjct: 368 QAFRNYMN 375 Lambda K H 0.316 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 506 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 489 Length of database: 379 Length adjustment: 32 Effective length of query: 457 Effective length of database: 347 Effective search space: 158579 Effective search space used: 158579 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
Align candidate AO353_08180 AO353_08180 (homoserine O-acetyltransferase)
to HMM TIGR01392 (metX: homoserine O-acetyltransferase (EC 2.3.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01392.hmm # target sequence database: /tmp/gapView.1439.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01392 [M=351] Accession: TIGR01392 Description: homoserO_Ac_trn: homoserine O-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-141 456.7 0.0 2.9e-141 456.5 0.0 1.0 1 lcl|FitnessBrowser__pseudo3_N2E3:AO353_08180 AO353_08180 homoserine O-acetylt Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo3_N2E3:AO353_08180 AO353_08180 homoserine O-acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 456.5 0.0 2.9e-141 2.9e-141 3 350 .. 22 374 .. 20 375 .. 0.97 Alignments for each domain: == domain 1 score: 456.5 bits; conditional E-value: 2.9e-141 TIGR01392 3 eeltlesGevlsevevayktyGtlnaerdNavlvcHaltgsahvagkadeedk..GWWdellGpg 65 e+l l +G l+ +++ y+tyGtlna +Navl+cHal+g++h+ag++++ed+ GWWd+ +Gpg lcl|FitnessBrowser__pseudo3_N2E3:AO353_08180 22 EPLALACGRSLPAYDLIYETYGTLNATASNAVLICHALSGHHHAAGYHSTEDRkpGWWDSCIGPG 86 789********************************************99888789********** PP TIGR01392 66 raldtsryfvvclNvlGsckGstgPlsinpetgkpygaefPlvtirDlvkaqkalldsLgvekla 130 +++dt+++fvv+lN+lG+c+GstgP+s+np+tgkp+ga+fP++t++D+v+ q++l+d++g++++a lcl|FitnessBrowser__pseudo3_N2E3:AO353_08180 87 KPIDTNKFFVVSLNNLGGCNGSTGPSSTNPDTGKPFGADFPVLTVEDWVHSQARLADRIGINQWA 151 ***************************************************************** PP TIGR01392 131 avvGgSlGGmqalewalsypervkkivvlatsarasaqaiafnevqrqailsDpeyndGeyaeee 195 av+GgSlGGmqa++w+++yp+r+++++++a+++++saq+iafnev+rqail+Dp++++G+++e + lcl|FitnessBrowser__pseudo3_N2E3:AO353_08180 152 AVIGGSLGGMQAIQWSITYPDRIRHCLAIASAPKLSAQNIAFNEVARQAILTDPDFHGGSFQEAG 216 ***************************************************************** PP TIGR01392 196 .qPekGLalARmlalltYrseesleerfgreakseeslassleeefsvesylryqgkkfverFdA 259 P++GL lARm++++tY+s++s+ e+fgr kse+ ++ ef+vesylryqg++f rFdA lcl|FitnessBrowser__pseudo3_N2E3:AO353_08180 217 vIPKRGLMLARMVGHITYLSDDSMGEKFGRGLKSEKLNYDFHSVEFQVESYLRYQGEEFSGRFDA 281 9********************************9977777779********************** PP TIGR01392 260 nsYllltkaldthdlargrrdslkealkkikapvlvvgiesDllftleeqeelakalkaakle.. 322 n+Yll+tkald++d a++ +d+l+++++ +ka+++v+++++D++f++++++el++al aak++ lcl|FitnessBrowser__pseudo3_N2E3:AO353_08180 282 NTYLLMTKALDYFDPAANFDDNLAKTFAGAKAKFCVMSFTTDWRFSPARSRELVDALMAAKKDvc 346 ***********************************************************999999 PP TIGR01392 323 yaeieseeGHDaFllekekveelirefl 350 y ei+ ++GHDaFl+ ++ ++ r+++ lcl|FitnessBrowser__pseudo3_N2E3:AO353_08180 347 YLEIDAPQGHDAFLIPIPRYLQAFRNYM 374 ***************9999888887776 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (379 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.48 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory