GapMind for Amino acid biosynthesis

 

Aligments for a candidate for preph-dehydratase in Pseudomonas fluorescens FW300-N2E3

Align arogenate dehydratase (EC 4.2.1.91) (characterized)
to candidate AO353_17845 AO353_17845 ArtI protein

Query= BRENDA::Q01269
         (268 letters)



>lcl|FitnessBrowser__pseudo3_N2E3:AO353_17845 AO353_17845 ArtI
           protein
          Length = 261

 Score =  253 bits (645), Expect = 4e-72
 Identities = 129/250 (51%), Positives = 171/250 (68%), Gaps = 3/250 (1%)

Query: 12  LACLALLASASLQAQE--SRLDRILESGVLRVATTGDYKPFSYRTEEGGYAGFDVDMAQR 69
           L C  L  S    AQ   S LD+++E G L+V TTGDYKP++Y   EGGY G D+ MAQ 
Sbjct: 6   LLCSLLTFSVQAIAQNAPSHLDQVIERGHLKVCTTGDYKPYTYLRAEGGYEGIDIAMAQS 65

Query: 70  LAESLGAKLVVVPTSWPNLMRDFADDRFDIAMSGISINLERQRQAYFSIPYLRDGKTPIT 129
           LA+SL   +  VPT+W NLM DF  DR DI M GIS++LERQ++A FS     DGK P+ 
Sbjct: 66  LAKSLNVDVQWVPTTWKNLMTDFLADRCDIGMGGISVSLERQKKAAFSDTLGVDGKIPLV 125

Query: 130 LCSEEARFQTLEQIDQPGVTAIVNPGGTNEKFARANLKKARILVHPDNVTIFQQIVDGKA 189
            C ++ R+QT+EQ++Q  V  I   GGTNE FAR +L  A + + PDNVTIF+Q+++ KA
Sbjct: 126 RCEDKQRYQTVEQLNQSSVRLIEPAGGTNEVFARTHLPNATLTLFPDNVTIFEQLLENKA 185

Query: 190 DLMMTDAIEARLQSRLHPELCAVHPQQPFDFAEKAYLLPRDE-AFKRYVDQWLHIAEQSG 248
           D+M+TDA EAR Q +L P LCAV+P+Q   ++EKAYLLPRD+ A+K YVDQWLH+++ +G
Sbjct: 186 DVMITDASEARYQQKLKPGLCAVNPEQYLQYSEKAYLLPRDDVAWKAYVDQWLHLSKATG 245

Query: 249 LLRQRMEHWL 258
                +  WL
Sbjct: 246 AYDAVLAQWL 255


Lambda     K      H
   0.322    0.135    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 214
Number of extensions: 5
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 268
Length of database: 261
Length adjustment: 25
Effective length of query: 243
Effective length of database: 236
Effective search space:    57348
Effective search space used:    57348
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 47 (22.7 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory