Align Phosphoserine phosphatase; PSP; PSPase; O-phosphoserine phosphohydrolase; EC 3.1.3.3 (characterized)
to candidate AO353_13070 AO353_13070 phosphoserine phosphatase
Query= SwissProt::Q9S281 (410 letters) >FitnessBrowser__pseudo3_N2E3:AO353_13070 Length = 404 Score = 264 bits (675), Expect = 3e-75 Identities = 167/392 (42%), Positives = 224/392 (57%), Gaps = 16/392 (4%) Query: 12 LLVKIFGKDRPGITAGLFDTLAAYSVDVVDIEQVVTRGRIVLCALVTEPPRGLEGDLRAT 71 +L+ I G DRPG+TA + LA V+++DI Q V + LV P + Sbjct: 5 VLINITGVDRPGLTAAITGVLAQGGVNILDIGQAVIHDTLSFGILVEIPDTEQGSSVLKD 64 Query: 72 VHSWAESLKLQAEIISGIGDNRP-----RGFGRSLVTVLGHPLTAEATAAIAARITESGS 126 + A L Q ++ +G R +VT+L +TAE +++ + G Sbjct: 65 ILFKAYELGQQVRFTPVSEEDYQLWVGAQGKKRHIVTLLTRKVTAEQLQRVSSITAKYGL 124 Query: 127 NIDRIFRLA-KYPVTA--------VEFAVSGVETEP--LRTALATEAAALGVDIAVVAAG 175 NID I RL+ + P+ +EF+V G +P LR + A L VDIA Sbjct: 125 NIDHIDRLSGRMPLDTPADKGKGCIEFSVRGEAADPQALRAEFLSVAQELNVDIAFQEDS 184 Query: 176 LHRRAQRLVVMDVDSTLIQDEVIELFAAHAGCEDEVAEVTAAAMRGELDFEQSLHARVAL 235 L RR +RL V D+DSTLI+ EVI+ A AG ++V+E+T AM GELDF S R+AL Sbjct: 185 LFRRNRRLAVFDMDSTLIEAEVIDELAKAAGVGEKVSEITERAMAGELDFRASFKERLAL 244 Query: 236 LAGLDASVVDKVRAEVRLTPGARTLIRTLKRLGYQVGVVSGGFTQVTDALQEQLGLDFAQ 295 L GLD SV+D + A +RLT GA TL LKRLGY+ ++SGGFT LQ +LG+D+ Sbjct: 245 LKGLDVSVLDSIGASLRLTEGAETLFAELKRLGYKTAILSGGFTYFAKQLQAKLGIDYVF 304 Query: 296 ANTLEIVDGRLTGRVTGEIVDRAGKARLLRRFAAAAGVPLSQTVAIGDGANDLDMLNAAG 355 AN LE+VDG++TG IVD KA LLR A G+ L QT+A+GDGANDL ML AG Sbjct: 305 ANELEVVDGKVTGVAVEPIVDAQRKADLLRELAHKEGLRLEQTIAVGDGANDLPMLAIAG 364 Query: 356 LGVAFNAKPVVREAAHTAVNVPFLDTVLYLLG 387 LGVAF AKP+V+++A A++ LD VLYLLG Sbjct: 365 LGVAFRAKPLVKQSAKQAISTLGLDGVLYLLG 396 Lambda K H 0.319 0.135 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 378 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 410 Length of database: 404 Length adjustment: 31 Effective length of query: 379 Effective length of database: 373 Effective search space: 141367 Effective search space used: 141367 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate AO353_13070 AO353_13070 (phosphoserine phosphatase)
to HMM TIGR00338 (serB: phosphoserine phosphatase SerB (EC 3.1.3.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00338.hmm # target sequence database: /tmp/gapView.14616.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00338 [M=219] Accession: TIGR00338 Description: serB: phosphoserine phosphatase SerB Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.6e-84 267.1 0.6 7.1e-84 266.8 0.6 1.1 1 lcl|FitnessBrowser__pseudo3_N2E3:AO353_13070 AO353_13070 phosphoserine phosph Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo3_N2E3:AO353_13070 AO353_13070 phosphoserine phosphatase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 266.8 0.6 7.1e-84 7.1e-84 1 219 [] 177 395 .. 177 395 .. 0.99 Alignments for each domain: == domain 1 score: 266.8 bits; conditional E-value: 7.1e-84 TIGR00338 1 diakselskllkkkklvvfDlDstlieeEvIdeiaklaGveeeVseiTerAmrgeldFkeslreR 65 dia +e+s ++++++l+vfD+Dstlie+EvIde+ak+aGv+e+VseiTerAm geldF++s++eR lcl|FitnessBrowser__pseudo3_N2E3:AO353_13070 177 DIAFQEDSLFRRNRRLAVFDMDSTLIEAEVIDELAKAAGVGEKVSEITERAMAGELDFRASFKER 241 688999999******************************************************** PP TIGR00338 66 vkllkglpvellkkveeklelteGveelvkkLkekgykvaviSGgFdlvaeklkekLgldavfaN 130 ++llkgl+v++l+ + +l+lteG+e l +Lk+ gyk+a++SGgF+++a++l++kLg+d+vfaN lcl|FitnessBrowser__pseudo3_N2E3:AO353_13070 242 LALLKGLDVSVLDSIGASLRLTEGAETLFAELKRLGYKTAILSGGFTYFAKQLQAKLGIDYVFAN 306 ***************************************************************** PP TIGR00338 131 rLevedgkltGkvegeivdesakaktllkllekegislektvavGDGanDlsmikaAglgiafna 195 +Lev dgk tG +ivd++ ka+ l +l++keg+ le+t+avGDGanDl+m++ Aglg+af a lcl|FitnessBrowser__pseudo3_N2E3:AO353_13070 307 ELEVVDGKVTGVAVEPIVDAQRKADLLRELAHKEGLRLEQTIAVGDGANDLPMLAIAGLGVAFRA 371 ***************************************************************** PP TIGR00338 196 kpvlkekadiviekkdltdilell 219 kp +k+ a+++i++ l ++l+ll lcl|FitnessBrowser__pseudo3_N2E3:AO353_13070 372 KPLVKQSAKQAISTLGLDGVLYLL 395 ***************999999886 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (219 nodes) Target sequences: 1 (404 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 11.69 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory