Align Tryptophan synthase beta chain 1; EC 4.2.1.20 (characterized, see rationale)
to candidate AO353_10710 AO353_10710 tryptophan synthase subunit beta
Query= uniprot:P50383 (425 letters) >FitnessBrowser__pseudo3_N2E3:AO353_10710 Length = 406 Score = 129 bits (324), Expect = 2e-34 Identities = 108/363 (29%), Positives = 163/363 (44%), Gaps = 54/363 (14%) Query: 72 IGRPTPLFRAKRLEEYLKTPARIYFKYEGATPTGSHKINTAIPQAYFAKEEGIEHVVTET 131 +GRP+PL+ A+RL E+ A+IY K E TG+HKIN I Q A+ G + ++ ET Sbjct: 60 VGRPSPLYFAERLTEFCGG-AKIYLKREELNHTGAHKINNCIGQILLARRMGKKRIIAET 118 Query: 132 GAGQWGTAVALAASMYNMKSTIFMVKVSYEQKPMRRSIMQLYGANVYASPTNLTEYGRKI 191 GAG G A A A+ + + I+M E++ M+L GA V Sbjct: 119 GAGMHGVATATVAARFGLDCVIYMGTTDIERQQANVFRMKLLGAEVIPVVAG-------- 170 Query: 192 LETNPQHPGSLGIAMSEAIEYALKN--EFRYLVGSVLD------VVLLHQSVIGQETITQ 243 G+L AM+EA+ + N YL+G+V +V Q+VIG+ET Q Sbjct: 171 -------TGTLKDAMNEALRDWVTNVDSTFYLIGTVAGPHPYPAMVRDFQAVIGKETREQ 223 Query: 244 LDLL-GEDADILIGCVGGGSNFGGFTYPFIGNKKGK--------------RYIAVSSAEI 288 L G D L+ C+GGGSN G +PF+ +K + ++ A + + Sbjct: 224 LQAKEGRLPDSLVACIGGGSNAMGLFHPFLDDKSVEIIGVEAAGHGIETGKHAASLNGGV 283 Query: 289 PKFSKGEYKYDFPDSAGLLPLVKMITLGKDYVPPPIYAGGLRYHGVAPTLSLLTKEGIVE 348 P G + D G + + + GL Y G+ P + L G V+ Sbjct: 284 PGVLHGNRTFLLQDDDGQI------------IDAHSISAGLDYPGIGPEHAWLHDIGRVQ 331 Query: 349 WREYNEREIFEAAKIFIENQGIVPAPESAHAIRAVVDEAIEARKNNERKVIVFNLSGHGL 408 + + E +A +GI+PA ESAHA+ V A K++ ++V NLSG G Sbjct: 332 YTSVTDHEALDAFHKCCRLEGIIPALESAHALAEVFKRAPTLPKDH---LMVVNLSGRGD 388 Query: 409 LDL 411 D+ Sbjct: 389 KDM 391 Lambda K H 0.318 0.138 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 377 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 406 Length adjustment: 31 Effective length of query: 394 Effective length of database: 375 Effective search space: 147750 Effective search space used: 147750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate AO353_10710 AO353_10710 (tryptophan synthase subunit beta)
to HMM TIGR00263 (trpB: tryptophan synthase, beta subunit (EC 4.2.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00263.hmm # target sequence database: /tmp/gapView.10334.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00263 [M=385] Accession: TIGR00263 Description: trpB: tryptophan synthase, beta subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.9e-198 643.8 0.0 5.7e-198 643.6 0.0 1.0 1 lcl|FitnessBrowser__pseudo3_N2E3:AO353_10710 AO353_10710 tryptophan synthase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo3_N2E3:AO353_10710 AO353_10710 tryptophan synthase subunit beta # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 643.6 0.0 5.7e-198 5.7e-198 1 384 [. 14 397 .. 14 398 .. 0.99 Alignments for each domain: == domain 1 score: 643.6 bits; conditional E-value: 5.7e-198 TIGR00263 1 gkfgefGGqyvpevllealeelekayekakkdeefkkeleellkeyagrptpltfaknlskklgg 65 g fg+fGG+yv+e+l++ + +l ++ye ak+d++fk+el ++ ++y+grp+pl+fa++l++ gg lcl|FitnessBrowser__pseudo3_N2E3:AO353_10710 14 GLFGAFGGRYVAETLMPLILDLAREYEAAKDDPAFKEELAYFQRDYVGRPSPLYFAERLTEFCGG 78 67*************************************************************** PP TIGR00263 66 akiylkredllhtGahkinnalgqallakrlGkkriiaetGaGqhGvatataaallglecevymG 130 akiylkre+l+htGahkinn +gq+lla+r+GkkriiaetGaG hGvatat+aa++gl+c++ymG lcl|FitnessBrowser__pseudo3_N2E3:AO353_10710 79 AKIYLKREELNHTGAHKINNCIGQILLARRMGKKRIIAETGAGMHGVATATVAARFGLDCVIYMG 143 ***************************************************************** PP TIGR00263 131 aedverqklnvfrmellgakvvpvtsGsktlkdavnealrdWvtsvedthyvlGsavGphPfPei 195 ++d+erq+ nvfrm+llga+v+pv G+ tlkda+nealrdWvt+v++t+y++G+++GphP+P++ lcl|FitnessBrowser__pseudo3_N2E3:AO353_10710 144 TTDIERQQANVFRMKLLGAEVIPVVAGTGTLKDAMNEALRDWVTNVDSTFYLIGTVAGPHPYPAM 208 ***************************************************************** PP TIGR00263 196 vrefqsvigeevkeqilekegrlPdaviacvGGGsnaiGifaafiedeeveligveagGkGidte 260 vr+fq+vig+e++eq+++kegrlPd ++ac+GGGsna+G+f++f++d++ve+igvea+G+Gi+t lcl|FitnessBrowser__pseudo3_N2E3:AO353_10710 209 VRDFQAVIGKETREQLQAKEGRLPDSLVACIGGGSNAMGLFHPFLDDKSVEIIGVEAAGHGIETG 273 ***************************************************************** PP TIGR00263 261 khaatlskGkeGvlhGaktkllqdedGqieeahsvsaGldypgvgPehaalaetgraeyeaitde 325 khaa+l+ G +GvlhG++t llqd+dGqi +ahs+saGldypg+gPeha+l+++gr++y+++td+ lcl|FitnessBrowser__pseudo3_N2E3:AO353_10710 274 KHAASLNGGVPGVLHGNRTFLLQDDDGQIIDAHSISAGLDYPGIGPEHAWLHDIGRVQYTSVTDH 338 ***************************************************************** PP TIGR00263 326 ealealkllskeeGiipalesshalaaleklapklkkdeivvvnlsGrGdkdletvaka 384 eal+a++++++ eGiipales+hala + k ap+l+kd+++vvnlsGrGdkd++tv+++ lcl|FitnessBrowser__pseudo3_N2E3:AO353_10710 339 EALDAFHKCCRLEGIIPALESAHALAEVFKRAPTLPKDHLMVVNLSGRGDKDMQTVMHH 397 ********************************************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (406 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 7.14 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory