Align Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 (uncharacterized)
to candidate AO353_00925 AO353_00925 aminodeoxychorismate synthase component I
Query= curated2:O66849 (494 letters) >FitnessBrowser__pseudo3_N2E3:AO353_00925 Length = 447 Score = 255 bits (652), Expect = 2e-72 Identities = 160/441 (36%), Positives = 236/441 (53%), Gaps = 24/441 (5%) Query: 47 NILLESAEGGEKWGRYSFIITGSSFYLRTRKDIGEIYERGKVNFFETKDPLSKIKEVVKK 106 ++LL+S + GRY + L D E G +D L+++ Sbjct: 28 SVLLDSGRPSAERGRYDVLSAWPVATLAVSPD-----ESGGAFLQRLRDTLARLGNAAIP 82 Query: 107 FIPYHDERLPRFWGGLVGYFAYDVVKFYEPVEDKNPDPIHTYDIYLVLTDVVVIHDNLTG 166 PY LP F GGL+GY +YD + E + + D + D L D +I D+LTG Sbjct: 83 -APYE---LP-FAGGLIGYLSYDFGRHLEALPSQAHDDLQLPDARFGLYDWAMISDHLTG 137 Query: 167 KIKVVVPIFAQNGIEEEYERAKNLIRDTVKKLKERGTTFLNVVEKEPDFKNWRSNFTKEE 226 ++V F N IE E +R L F PD + + Sbjct: 138 SSQLV---FHPNLIESERQRLIELFSQPAAAAT---APFTLSGAMSPDL-------SASD 184 Query: 227 FEDIVKKAKEYIAQGDVIQVVLSQRFRKRFKGNPDNIYRVLRFLNPSPYMYYLDF-DQLK 285 ++ + ++YI GD QV +QRFR + +G+P Y LR P+P+ + D Sbjct: 185 YQQAFVRIQQYIQAGDCYQVNFAQRFRAQCQGDPWTAYCALRAACPTPFSGFQSLPDGGA 244 Query: 286 VIGSSPEILVRLEEGRIETRPIAGTRKRGRTEEEDKRLEEDLLSDEKERAEHLMLVDLAR 345 V+ SPE V++ EG +ETRPI GTR RG+ ED +LL+ K+RAE+LM+VDL R Sbjct: 245 VLSLSPERFVKVSEGHVETRPIKGTRPRGQNAAEDAANAAELLASPKDRAENLMIVDLLR 304 Query: 346 NDIGRVAKTGSVRVENFMRIERYSHVMHIVSDVVGELREGYDALDVLKATFPAGTVSGAP 405 ND+GR + GSVRV +E Y +V H+VS V GEL + DALD++ +FP G+++GAP Sbjct: 305 NDLGRTCRIGSVRVPELFSLESYPNVHHLVSSVTGELADNKDALDLIAGSFPGGSITGAP 364 Query: 406 KVRAMQIIEELENERRGIYAGSVGYISFQGNMDMAIAIRTAVYRDRDIFVQAGAGIVADS 465 K+RAMQII+ELE RRG+Y GS+ Y+ +G MD +IAIR+ + +D + G GIVADS Sbjct: 365 KIRAMQIIDELEPTRRGLYCGSLLYLDVRGEMDSSIAIRSLLVKDGQVCCWGGGGIVADS 424 Query: 466 VPEKEWEETVNKAKALMKAIE 486 + E++E++ K K L++ ++ Sbjct: 425 DWQAEYQESITKVKVLLETLQ 445 Lambda K H 0.318 0.138 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 495 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 494 Length of database: 447 Length adjustment: 33 Effective length of query: 461 Effective length of database: 414 Effective search space: 190854 Effective search space used: 190854 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory