GapMind for Amino acid biosynthesis

 

Protein AO356_25355 in Pseudomonas fluorescens FW300-N2C3

Annotation: AO356_25355 aspartate aminotransferase

Length: 404 amino acids

Source: pseudo5_N2C3_1 in FitnessBrowser

Candidate for 7 steps in Amino acid biosynthesis

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-phenylalanine biosynthesis ilvE hi aspartate transaminase (EC 2.6.1.1); glutamate-prephenate aminotransferase (EC 2.6.1.79) (characterized) 57% 98% 466.8 2-aminoadipate:2-oxoglutarate aminotransferase (EC 2.6.1.39) 52% 422.2
L-phenylalanine biosynthesis ptransferase hi aspartate transaminase (EC 2.6.1.1); glutamate-prephenate aminotransferase (EC 2.6.1.79) (characterized) 57% 98% 466.8 2-aminoadipate:2-oxoglutarate aminotransferase (EC 2.6.1.39) 52% 422.2
L-tyrosine biosynthesis ptransferase hi aspartate transaminase (EC 2.6.1.1); glutamate-prephenate aminotransferase (EC 2.6.1.79) (characterized) 57% 98% 466.8 2-aminoadipate:2-oxoglutarate aminotransferase (EC 2.6.1.39) 52% 422.2
L-tyrosine biosynthesis tyrB hi aspartate transaminase (EC 2.6.1.1); glutamate-prephenate aminotransferase (EC 2.6.1.79) (characterized) 57% 98% 466.8 2-aminoadipate:2-oxoglutarate aminotransferase (EC 2.6.1.39) 52% 422.2
L-lysine biosynthesis lysN med 2-aminoadipate:2-oxoglutarate aminotransferase (EC 2.6.1.39) (characterized) 52% 96% 422.2 aspartate transaminase (EC 2.6.1.1); glutamate-prephenate aminotransferase (EC 2.6.1.79) 57% 466.8
L-lysine biosynthesis dapX lo Probable N-acetyl-LL-diaminopimelate aminotransferase; Putative aminotransferase A; EC 2.6.1.- (characterized) 37% 90% 213 aspartate transaminase (EC 2.6.1.1); glutamate-prephenate aminotransferase (EC 2.6.1.79) 57% 466.8
L-lysine biosynthesis DAPtransferase lo LL-diaminopimelate aminotransferase; DAP-AT; DAP-aminotransferase; LL-DAP-aminotransferase; EC 2.6.1.83 (uncharacterized) 32% 94% 169.1 aspartate transaminase (EC 2.6.1.1); glutamate-prephenate aminotransferase (EC 2.6.1.79) 57% 466.8

Sequence Analysis Tools

View AO356_25355 at FitnessBrowser

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search PFam (including for weak hits, up to E = 1)

Predict protein localization: PSORTb (Gram negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the SEED with FIGfam search

Fitness BLAST: loading...

Sequence

MSVDIQRLNRRLARAQSSATYRIMDRVAERRAQGAKIISLCAGEPDFDTPKHIREAAIEA
IGQGHTRYTQVAGVRSLREAVAAKFRQENGLDVTWQDTLVCNGGKQVIYNALAATLDEGD
QVIVPAPYWVSYPEMVQLCGGESRIVTCDADSGFKLTPAALDAAITPQTRWLILNSPSNP
TGAVYSREELQALADVLLAHPHVLILADDIYEHLIFDDQVFYTLAQVEPRLASRTLTMNG
VSKAYAMTGWRIGFATGPRWLLEAMEKLQGQQTSGASSISQQAALAALDGPKDFIRESRA
VFQRRRDLMVALLNATPGLACASPGGAFYAFASCAGLIGRTSSGGRVLHTDEDVAHALLD
EADVAVVHGSAFGLGPYIRIAYALDDASLRQACEAIRGFCDALR

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory