Align N-acetylglutamylphosphate reductase (EC 1.2.1.38) (characterized)
to candidate AO356_24070 AO356_24070 N-acetyl-gamma-glutamyl-phosphate reductase
Query= reanno::Smeli:SMc01801 (310 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_24070 Length = 309 Score = 281 bits (719), Expect = 1e-80 Identities = 146/308 (47%), Positives = 201/308 (65%), Gaps = 5/308 (1%) Query: 3 PKIFIDGEHGTTGLQIRVRMAGRTDLELLSIPEAERRNAAMREDLLNSADIAILCLPDDA 62 P +FIDG+ GTTGLQI R+ R+DL LL++ R++ R + +N DIA+LCLPD A Sbjct: 4 PLVFIDGDQGTTGLQIHQRLRDRSDLRLLTLSADYRKDPQRRAEAINDCDIAMLCLPDPA 63 Query: 63 SREAVAMVAGNNRVRIIDTSTAHRVAPDWAYGFAEMDKAQPQRIRDARHVANPGCYPTGA 122 +R+AVA + N VR+ID S+AHR PDW YGFA+M+ Q +RI AR V+NPGCYPTGA Sbjct: 64 ARDAVASIK-NPAVRVIDASSAHRTHPDWVYGFAQMNSQQARRIATARRVSNPGCYPTGA 122 Query: 123 IALIRPLRQAGILPDGYPVTVNAVSGYTGGGKQMIAQMEDDQNPDHIGAPHF-LYGLTLK 181 I L+RPL +AG+LP YP+ + AVSGY+G G+ A +++ + + AP F +YGL L Sbjct: 123 IGLLRPLLEAGLLPTDYPMNIYAVSGYSGKGR---AGVQEYEGEGALPAPAFQVYGLGLA 179 Query: 182 HKHVPEMKMHGLLERAPVFSPSVGKFAQGMIVQVPLYLEDLAAGATLETIHRALVDHYAG 241 HKHVPE++ L P+F P+ G F QG+ + +P+ LA G + +H L HYA Sbjct: 180 HKHVPEIQQQSGLTERPMFVPAYGAFRQGIALTIPVQTRLLAPGVSAVQLHACLARHYAD 239 Query: 242 QSIVEVVPLDESAKLARIDATELAGSDAMKLFVFGTKGGAHVNLVALLDNLGKGASGAAV 301 V V+ + E+ +L +D L G+D ++L VF V L A+ DNLGKGA+GAAV Sbjct: 240 AGHVHVMSMQEAKELTFLDPQALNGTDDLRLSVFENDETGQVLLAAVFDNLGKGAAGAAV 299 Query: 302 QNMDLMLS 309 QN+DLML+ Sbjct: 300 QNLDLMLA 307 Lambda K H 0.319 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 270 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 310 Length of database: 309 Length adjustment: 27 Effective length of query: 283 Effective length of database: 282 Effective search space: 79806 Effective search space used: 79806 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate AO356_24070 AO356_24070 (N-acetyl-gamma-glutamyl-phosphate reductase)
to HMM TIGR01851 (argC: N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01851.hmm # target sequence database: /tmp/gapView.3352.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01851 [M=310] Accession: TIGR01851 Description: argC_other: N-acetyl-gamma-glutamyl-phosphate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.2e-123 396.2 0.0 6e-123 396.0 0.0 1.0 1 lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_24070 AO356_24070 N-acetyl-gamma-gluta Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_24070 AO356_24070 N-acetyl-gamma-glutamyl-phosphate reductase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 396.0 0.0 6e-123 6e-123 2 308 .. 4 306 .. 3 308 .. 0.98 Alignments for each domain: == domain 1 score: 396.0 bits; conditional E-value: 6e-123 TIGR01851 2 pkvfidGeaGttGlqirerlaerddlellsidedkrkdaderakllnaadvailclpddaare 64 p vfidG++GttGlqi++rl +r+dl+ll++++d rkd++ ra+ +n d+a+lclpd aar+ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_24070 4 PLVFIDGDQGTTGLQIHQRLRDRSDLRLLTLSADYRKDPQRRAEAINDCDIAMLCLPDPAARD 66 679************************************************************ PP TIGR01851 65 avslvdnpntkildastayrtaedwvyGfpelaaeqrekianakrvanPGcyatgaiallrPl 127 av+ ++np+++++das+a+rt++dwvyGf++++++q +ia a+rv+nPGcy+tgai llrPl lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_24070 67 AVASIKNPAVRVIDASSAHRTHPDWVYGFAQMNSQQARRIATARRVSNPGCYPTGAIGLLRPL 129 *************************************************************** PP TIGR01851 128 veaGilPadfPvtinavsGysGGGkaliakyeeesaddskkaafiiyglalehkhlpemrkhs 190 +eaG+lP+d+P++i avsGysG G+a +++ye e a ++ af++ygl l hkh+pe++++s lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_24070 130 LEAGLLPTDYPMNIYAVSGYSGKGRAGVQEYEGEGALPA--PAFQVYGLGLAHKHVPEIQQQS 190 ********************************7776665..89******************** PP TIGR01851 191 glaskPiftPavGdfaqGllveiplhlaeldskvsaedihkalaeyykGekfvkvaelddael 253 gl+++P+f+Pa G f qG++++ip++ l+ vsa ++h+ la +y+ +v+v+++++a+ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_24070 191 GLTERPMFVPAYGAFRQGIALTIPVQTRLLAPGVSAVQLHACLARHYADAGHVHVMSMQEAKE 253 **************************************************************9 PP TIGR01851 254 lddtildaqglngtnrlelfvfgsddgerallvarldnlGkGasGaavqnlnial 308 l t+ld+q+lngt+ l l vf +d+++++ll+a +dnlGkGa+Gaavqnl+++l lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_24070 254 L--TFLDPQALNGTDDLRLSVFENDETGQVLLAAVFDNLGKGAAGAAVQNLDLML 306 9..***************************************************9 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (310 nodes) Target sequences: 1 (309 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.36 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory