GapMind for Amino acid biosynthesis

 

Alignments for a candidate for asnB in Pseudomonas fluorescens FW300-N2C3

Align asparagine synthase (glutamine-hydrolysing) 1; EC 6.3.5.4 (characterized)
to candidate AO356_03575 AO356_03575 asparagine synthase

Query= CharProtDB::CH_005185
         (632 letters)



>FitnessBrowser__pseudo5_N2C3_1:AO356_03575
          Length = 590

 Score =  262 bits (670), Expect = 3e-74
 Identities = 192/626 (30%), Positives = 295/626 (47%), Gaps = 56/626 (8%)

Query: 1   MCGFVGV--FNKHPLAQTADQEELIKQMNQMIVHRGPDSDGYFHDEHVGFGFRRLSIIDV 58
           MCG  G   F++ P    A     ++++   +  RGPD+ G+     +  G RRL I+D+
Sbjct: 1   MCGLAGELRFDQQPADLAA-----VERITHHLAPRGPDAWGFHSQGPIALGHRRLKIMDL 55

Query: 59  ENGG-QPLSYEDETYWIIFNGEIYNYIELREELEAKGYTFNTDSDTEVLLATYRHYKEEA 117
            +G  QP+        + FNG IYNY ELR ELEA GYTF +  DTEVLL  Y  + E  
Sbjct: 56  SDGSAQPMIDNQLGLSLAFNGAIYNYPELRTELEALGYTFYSGGDTEVLLKGYHAWGEAL 115

Query: 118 ASKLRGMFAFLIWNKNDHVLYGARDPFGIKPLYYTTINDQVYFASERKSLMVAQNDIE-- 175
             KL GMFAF IW ++   L+ ARD  G+KPLY +    ++ FAS   +L+    DI   
Sbjct: 116 LPKLNGMFAFAIWERDAKRLFIARDRLGVKPLYLSRTGQRLRFASALPALLKG-GDINPM 174

Query: 176 IDKEALQQYMSFQ-FVPEPSTLDAHVKKVEPGSQFTIRPDGDITFKTYFKANFKPVQTEE 234
           +D  AL  Y++F   VP P TL A V+K+ P +   I  DG    KT++   + P   E+
Sbjct: 175 LDPVALNHYLNFHAVVPAPRTLLAGVEKLPPATWMRIEADGTTEQKTWWTLPYGPRADEQ 234

Query: 235 ----DKLVKEVRDAIYDSVNVHMRSDVPVGSFLSGGIDSSFIVSVAKEFH-PSLKTFSVG 289
               +  +  V D+  ++V +  R+ V VG  LSGG+DSS +V + +E     L TFS+G
Sbjct: 235 HLNLEDWIDRVLDSTREAVAIRQRAAVDVGVLLSGGVDSSMLVGLLREVGVEDLSTFSIG 294

Query: 290 FEQQG---FSEVDVAKETAAALGIENISKVISPEEYMNELPKIVWHFDDPLADPAAIPLY 346
           F+  G     E   +   A   G  +    I  +E + +LP       +P+     I  Y
Sbjct: 295 FQDAGGERGDEFQYSDLIAKHYGTRHHQLRIDEKEIIEQLPAAFRAMSEPMVSHDCIAFY 354

Query: 347 FVAKEAKKHVTVALSGEGADELFGGYNIYREPLSLKPFERIPSGLKKMLLHVAAVMPEGM 406
            +++E  KH  V  SG+GADELF GY+ Y +                      A  P   
Sbjct: 355 LLSREVAKHCKVVQSGQGADELFAGYHWYPQV-------------------DGASDPYAA 395

Query: 407 RGKSLLERGCTPLQDRYIGNAKIFEESVKKQLLKHYNPNLSYRDVTKTYFTESSSYSDIN 466
              +  +R               +EE            N +  D  K +F +  + + ++
Sbjct: 396 YRAAFFDRS--------------YEEYAATVQPNWLTANDAAGDFVKEHFAQPGADAAVD 441

Query: 467 KMQYVDIHTWMRGDILLKADKMTMANSLELRVPFLDKVVFDVASKIPDELKTKNGTTKYL 526
           K   +D    +  D + + D MTMA  LE R PFLD  + ++++++P + K  +G  K +
Sbjct: 442 KALRLDSTVMLVDDPVKRVDNMTMAWGLEARTPFLDYRLVELSARVPAQFKLPDG-GKQV 500

Query: 527 LRKAAEGIVPEHVLNRKKLGFPVPIRHWLKNEMNEWVRNIIQESQTDAYIHKDYVL-QLL 585
           L++AA  ++P  V++RKK  FPVP    L+     WVR ++ +   D  +    +L +LL
Sbjct: 501 LKEAARRVIPSEVIDRKKGYFPVPGLKHLEGHTLAWVRELLLDPSQDRGLFNPAMLDRLL 560

Query: 586 EDHCADKAD-NSRKIWTVLIFMIWHS 610
            D           ++W +    +W S
Sbjct: 561 TDPNGQLTPLRGSRLWQLAALNLWLS 586


Lambda     K      H
   0.319    0.136    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 914
Number of extensions: 42
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 632
Length of database: 590
Length adjustment: 37
Effective length of query: 595
Effective length of database: 553
Effective search space:   329035
Effective search space used:   329035
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

Align candidate AO356_03575 AO356_03575 (asparagine synthase)
to HMM TIGR01536 (asnB: asparagine synthase (glutamine-hydrolyzing) (EC 6.3.5.4))

Software error:

../bin/blast/fastacmd -i /tmp/list.9820.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.9820.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.