GapMind for Amino acid biosynthesis

 

Alignments for a candidate for asnB in Pseudomonas fluorescens FW300-N2C3

Align asparagine synthase (glutamine-hydrolysing) 3; EC 6.3.5.4 (characterized)
to candidate AO356_26510 AO356_26510 asparagine synthase

Query= CharProtDB::CH_007942
         (614 letters)



>FitnessBrowser__pseudo5_N2C3_1:AO356_26510
          Length = 631

 Score =  177 bits (449), Expect = 1e-48
 Identities = 158/582 (27%), Positives = 239/582 (41%), Gaps = 78/582 (13%)

Query: 1   MCGITGWVDFKKQLVQEKQTMDRMTDTLSKRGPDDSNVWGEHHVL--FGHKRLAVVDIEG 58
           MCG    V    Q      T+D   DTL  RGPD    W     L   G  RLA+V    
Sbjct: 1   MCGFV--VACHHQAPVPTVTLDAALDTLRHRGPDGRASWLSADGLCGIGFHRLAMVGARE 58

Query: 59  GRQPMACTYKGDTYTIIYNGELYNTEDLRKELRARGHQFERTSDTEVLLHSYIEWQEDCV 118
             QP    +  D   ++ NGE+Y     R++L A G  F   SD EV+ H Y++   D V
Sbjct: 59  QTQP----FHTDDVHVVVNGEIYQYAAQRQKLEAAGACFATDSDCEVVAHGYLQLGIDYV 114

Query: 119 DHLNGIFAFAVWDEKRNLLFAARDRLGVKPFFYTKEGSSFLFGSEIKAILAHPDIKARVD 178
             LNG FA  +WD +R  LFA RDR GVKP FY          SEIKA++A    + R D
Sbjct: 115 RELNGEFAGVIWDARRRKLFAIRDRWGVKPLFYRLSDQGIHLASEIKALIA-LGAQPRWD 173

Query: 179 RTGLSEIF--GLGPSRTPGTGIFKGIKEIRPAHALTFSKDGLNIWRYWNVESEKHTDSFD 236
              L + F   +GP++T    +F+GI ++ P H L +S  G  +    +   E H  +  
Sbjct: 174 HAALFQHFFASIGPAQT----LFEGIHQVPPGHVLEWSTQGYGVTPLLSAVDEAHDAARQ 229

Query: 237 DTVANVRSL-------FQDAVTRQLVSDVPVCTFLSGGLDSSAITAIAAGHFEKEGKAPL 289
              +  R          + AV  +   D PV  +LSGG+DS+ + A+AA H    G+  L
Sbjct: 230 HLASAPREWMPRLVDGLRHAVQDRFQGDGPVACYLSGGVDSATVAALAARH----GREGL 285

Query: 290 HTYSIDYEENDKYFQASAFQPNDDGPWIEKMTEAFGTTHHKCVISQKDLVDHLEEAVLVK 349
             +++D+               DD      +  + G  H    +S+  LVDH  +AV   
Sbjct: 286 SAFTVDFGAG-----------TDDATQAAGIAASLGLRHEVVPVSEAQLVDHFADAVRHA 334

Query: 350 DLPGMADVDSSLLWFCREI--KKDFVVSLSGECADEIFGGYPWFH--------------- 392
           +  G   + ++  W    +     +   L+G+ ADE+F GY +                 
Sbjct: 335 ETIGFNTIGAA-RWILGRVLASSGYKAVLAGDGADELFAGYSFSSVERLCARSHNHARLM 393

Query: 393 -----------TADVESGFPWMRSTEER----IKLLSDSWQ-KKLNLKEYVNAKYEETLA 436
                       A++    P      +R    +  L  SW  ++  L+  +  ++ E   
Sbjct: 394 TQVLEGGRQGLAAELGQPLPLFDMDPDRFGGQVPYLLASWNYQRSGLRPLLRTQFLEAFR 453

Query: 437 E---TPLLDGETGVDKA---RRQLFYLNMLWFMTNLLDRKDRMSMGASLEVRVPFADHRL 490
                 +L  +TG   A   RR L       F  ++L   +R  M   +E R PF D+R+
Sbjct: 454 HFNPYEVLMQQTGASAASGLRRSLHLWQKSMFANHIL-VSERFDMAHGIETRYPFLDNRV 512

Query: 491 VEYVWNIPWEMKMHDNREKGILRKALEGILPDDILYRKKSPY 532
                 +P E  +     K  LR+A+  + P+      K P+
Sbjct: 513 TAVAAMLPDEWLVEGAENKRFLREAVAALTPEAARCAAKRPF 554


Lambda     K      H
   0.320    0.137    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 880
Number of extensions: 51
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 3
Number of HSP's successfully gapped: 2
Length of query: 614
Length of database: 631
Length adjustment: 37
Effective length of query: 577
Effective length of database: 594
Effective search space:   342738
Effective search space used:   342738
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (25.4 bits)

Align candidate AO356_26510 AO356_26510 (asparagine synthase)
to HMM TIGR01536 (asnB: asparagine synthase (glutamine-hydrolyzing) (EC 6.3.5.4))

Software error:

../bin/blast/fastacmd -i /tmp/list.20822.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.20822.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.