GapMind for Amino acid biosynthesis

 

Alignments for a candidate for hisG in Pseudomonas fluorescens FW300-N2C3

Align ATP phosphoribosyltransferase; ATP-PRT; ATP-PRTase; EC 2.4.2.17 (uncharacterized)
to candidate AO356_06970 AO356_06970 ATP phosphoribosyltransferase

Query= curated2:Q6FEC9
         (228 letters)



>FitnessBrowser__pseudo5_N2C3_1:AO356_06970
          Length = 211

 Score =  276 bits (705), Expect = 3e-79
 Identities = 139/207 (67%), Positives = 168/207 (81%)

Query: 22  LTLALSKGRILKETLPLLEAAGINLLEDPEKSRKLIFPTTHQKVRILILRASDVPTYVEN 81
           LT+ALSKGRIL +TLPLL  AGI   E+P+KSRKLI PTT   VR+LI+RA+DVPTYVE+
Sbjct: 2   LTIALSKGRILDDTLPLLAEAGIVPTENPDKSRKLIIPTTQADVRLLIVRATDVPTYVEH 61

Query: 82  GAADFGVAGKDVLMEHGAQHVYELLDLKIANCKLMTAGKVGMQHPKGRLKIATKYVNLTR 141
           GAAD GVAGKDVLME+G Q +YE LDL+IA CKLMTAGKVG   PKGRL++ATK+VN+ +
Sbjct: 62  GAADLGVAGKDVLMEYGGQGLYEPLDLRIARCKLMTAGKVGAPEPKGRLRVATKFVNIAK 121

Query: 142 QYYASLGEQVDVIKLYGSMELAPLVGLGDYIVDVVDTGNTLRANGLEPLEEIMKVSSRLI 201
           +YYA  G QVD+IKLYGSMELAPL+GL D I+DVVDTGNTLRANGLEP + I  ++SRLI
Sbjct: 122 RYYAEQGRQVDIIKLYGSMELAPLIGLADKIIDVVDTGNTLRANGLEPQDFIADITSRLI 181

Query: 202 VNKASFKRKQALLDPILAQVEEAVNQR 228
           VNKAS K + A +  ++  + +AV  R
Sbjct: 182 VNKASMKMQHARIQALIDTLRKAVESR 208


Lambda     K      H
   0.318    0.137    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 214
Number of extensions: 4
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 228
Length of database: 211
Length adjustment: 22
Effective length of query: 206
Effective length of database: 189
Effective search space:    38934
Effective search space used:    38934
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 45 (21.9 bits)

Align candidate AO356_06970 AO356_06970 (ATP phosphoribosyltransferase)
to HMM TIGR00070 (hisG: ATP phosphoribosyltransferase (EC 2.4.2.17))

Software error:

../bin/blast/fastacmd -i /tmp/list.13467.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.13467.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.