GapMind for Amino acid biosynthesis

 

Alignments for a candidate for hisH in Pseudomonas fluorescens FW300-N2C3

Align IGP synthase glutamine amidotransferase subunit; EC 2.4.2.- (characterized)
to candidate AO356_03385 AO356_03385 imidazole glycerol phosphate synthase subunit HisH

Query= CharProtDB::CH_024511
         (196 letters)



>FitnessBrowser__pseudo5_N2C3_1:AO356_03385
          Length = 202

 Score =  144 bits (362), Expect = 1e-39
 Identities = 86/202 (42%), Positives = 122/202 (60%), Gaps = 10/202 (4%)

Query: 3   VVILDTGCANLNSVKSAIARHGYEPKVSRDPDVVLLADKLFLPGVGTAQAAMDQVREREL 62
           +V++D G  N+ SV + + R G + K S   D ++ A+KL LPGVG   A M  +RE  L
Sbjct: 2   IVVVDYGVGNIASVLNMLKRVGAKAKSSNLVDDIVNAEKLILPGVGAFDAGMKTLRESGL 61

Query: 63  FDLIK----ACTQPVLGICLGMQLLGRRSEESNGVDL-LGIIDEDVPKMTDFG-LPLPHM 116
            D++        +PV+G+CLG Q+LGRRSEE  GV+  LG ID D+ +        +PHM
Sbjct: 62  IDVLNQQVLVARKPVMGVCLGSQMLGRRSEE--GVEPGLGWIDMDIKRFEKRPERKVPHM 119

Query: 117 GWNRVYPQAGNRLFQGIEDGAYFYFVHSYAM-PVNPW-TIAQCNYGEPFTAAVQKDNFYG 174
           GW+ V     + L +G+ + + +YFVH Y M P N   T+   +YG+ FTAAV KDN +G
Sbjct: 120 GWSHVSCNYEHPLVRGLTEESRYYFVHGYYMCPDNERDTLLTADYGQKFTAAVAKDNIFG 179

Query: 175 VQFHPERSGAAGAKLLKNFLEM 196
            QFHPE+S   G +L KNF+E+
Sbjct: 180 FQFHPEKSHRFGMQLFKNFVEL 201


Lambda     K      H
   0.322    0.140    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 139
Number of extensions: 9
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 196
Length of database: 202
Length adjustment: 21
Effective length of query: 175
Effective length of database: 181
Effective search space:    31675
Effective search space used:    31675
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 45 (21.9 bits)

Align candidate AO356_03385 AO356_03385 (imidazole glycerol phosphate synthase subunit HisH)
to HMM TIGR01855 (hisH: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit (EC 2.4.2.-))

Software error:

../bin/blast/fastacmd -i /tmp/list.28521.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.28521.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.