GapMind for Amino acid biosynthesis

 

Alignments for a candidate for hisH in Pseudomonas fluorescens FW300-N2C3

Align Imidazole glycerol phosphate synthase subunit HisH; EC 4.3.2.10; IGP synthase glutaminase subunit; EC 3.5.1.2; IGP synthase subunit HisH; ImGP synthase subunit HisH; IGPS subunit HisH (uncharacterized)
to candidate AO356_09810 AO356_09810 imidazole glycerol phosphate synthase subunit HisH

Query= curated2:Q48C78
         (212 letters)



>FitnessBrowser__pseudo5_N2C3_1:AO356_09810
          Length = 212

 Score =  402 bits (1034), Expect = e-117
 Identities = 192/212 (90%), Positives = 200/212 (94%)

Query: 1   MQTVAVIDYGMGNLHSVAKALEHVGAGRVLITSDAKVIREADRVVFPGVGAIRDCMAEIR 60
           MQTVAVIDYGMGNLHSVAKALEHVGAG+VLITSDA VIREADRVVFPGVGAIRDCMAEIR
Sbjct: 1   MQTVAVIDYGMGNLHSVAKALEHVGAGKVLITSDADVIREADRVVFPGVGAIRDCMAEIR 60

Query: 61  RLGFDSLVREVSQDRPFLGICVGMQALLDRSEESGGVDCIGLFPGQVKFFGKDLYEEGEH 120
           RLGFD LV EVSQDRPFLGICVGMQALLDRSEE+ GVDCI LFPGQVKFFGK L+E+GEH
Sbjct: 61  RLGFDKLVHEVSQDRPFLGICVGMQALLDRSEENDGVDCISLFPGQVKFFGKGLHEDGEH 120

Query: 121 LKVPHMGWNQVAQAVDHPLWHDIPDLARFYFVHSFYIDAANQRQVVGRGHYGLDFAAALA 180
           LKVPHMGWN+V Q VDHPLWH+IPDLARFYFVHS+YI A N RQVVG GHYG+DFAAALA
Sbjct: 121 LKVPHMGWNEVKQTVDHPLWHNIPDLARFYFVHSYYIAAGNARQVVGSGHYGVDFAAALA 180

Query: 181 DGSRFAVQFHPEKSHTHGLQLLQNFAAWDGRW 212
           DGSRFAVQFHPEKSHTHGLQLLQNFAAWDGRW
Sbjct: 181 DGSRFAVQFHPEKSHTHGLQLLQNFAAWDGRW 212


Lambda     K      H
   0.325    0.141    0.447 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 296
Number of extensions: 5
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 212
Length of database: 212
Length adjustment: 21
Effective length of query: 191
Effective length of database: 191
Effective search space:    36481
Effective search space used:    36481
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 45 (21.9 bits)

Align candidate AO356_09810 AO356_09810 (imidazole glycerol phosphate synthase subunit HisH)
to HMM TIGR01855 (hisH: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit (EC 2.4.2.-))

Software error:

../bin/blast/fastacmd -i /tmp/list.3009.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.3009.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.