Align O-acetyl-L-homoserine sulfhydrylase; OAH-sulfhydrylase; EC 2.5.1.49 (characterized)
to candidate AO356_19910 AO356_19910 cystathionine gamma-synthase
Query= SwissProt::Q79VI4 (437 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_19910 Length = 381 Score = 119 bits (299), Expect = 1e-31 Identities = 107/403 (26%), Positives = 175/403 (43%), Gaps = 63/403 (15%) Query: 35 PIYQSTAFVFDSAEHAKQRFALEDLGPVYSRLTNPTVEALENRIASLEGGVHAVAFSSGQ 94 PIYQ +AF DSA YSR NP V LE +ASLEG HA+A+S+G Sbjct: 23 PIYQCSAFNADSAFF-------------YSRKANPNVTELEQVVASLEGSEHALAYSTGM 69 Query: 95 AATTNAILNLAGAGDHIVTSPRLYGGTETLFLITLNRLGIDVSFVENPDDPESWQAAVQP 154 +A +L L G +V + +YG + LF R+G ++ ++ A+ Sbjct: 70 SAIY-MVLELLKPGASLVINKYIYGCSYKLFQRYAARIGAHLTILDLTT--AEGLKALPA 126 Query: 155 NTKAFFGETFANPQADVLDIPAVAEVA--HRNSVPLIIDNTIATAALVRPLELGADVVVA 212 N ET NP +DI AV+ H +++DNT AT +PL GAD+ + Sbjct: 127 NVDMVIFETPTNPFLKDIDIHAVSRAVKQHNPQALVVVDNTWATPIFQKPLNFGADISLY 186 Query: 213 SLTKFYTGNGSGLGGVLIDGGKFDWTVEKDGKPVFPYFVTPDAAYHGLKYADLGAPAFGL 272 S TK+++G+ +GG+++ V + Y+ L L Sbjct: 187 SATKYFSGHSDVMGGLVL--------------------VNNETIYNRL-----------L 215 Query: 273 KVRVGLLRDTGSTLSAFNAWAAVQGIDTLSLRLERHNENAIKVAEFLNNHEKVEKVNFAG 332 + R +G+ L+ +AW + + T +LR+E+H++ + +L +E V Sbjct: 216 EGRF----YSGTILTPNSAWLLRRSMQTFNLRMEKHSQTTASMLNYLRELPFIEHV---- 267 Query: 333 LKDSPWYATKEKLGLKYTGSVLTFEIKGGKDEAW-AFIDALKLHSNLANIGDVRSLVVHP 391 +Y + L G ++ +I+ + F ALK + V S+V P Sbjct: 268 -----YYPRIDGRQLSGYGGIVFVDIRPDLVPFYKTFTSALKWFGTGTGMACVTSMVAQP 322 Query: 392 ATTTHSQSDEAGLARAGVTQSTVRLSVGIETIDDIIADLEGGF 434 + +H+ + A G+ + VRL G+E I+D+ DL F Sbjct: 323 FSGSHASMTDQEKADMGIEKGLVRLCFGLEDIEDLKEDLLQAF 365 Lambda K H 0.316 0.133 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 392 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 437 Length of database: 381 Length adjustment: 31 Effective length of query: 406 Effective length of database: 350 Effective search space: 142100 Effective search space used: 142100 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory