GapMind for Amino acid biosynthesis

 

Alignments for a candidate for OAT in Pseudomonas fluorescens FW300-N2C3

Align Ornithine aminotransferase 1; OAT 1; EC 2.6.1.13; Ornithine--oxo-acid aminotransferase 1 (uncharacterized)
to candidate AO356_17010 AO356_17010 acetylornithine aminotransferase

Query= curated2:Q5HJI8
         (394 letters)



>FitnessBrowser__pseudo5_N2C3_1:AO356_17010
          Length = 391

 Score =  282 bits (722), Expect = 1e-80
 Identities = 156/376 (41%), Positives = 225/376 (59%), Gaps = 10/376 (2%)

Query: 16  YAPLKLVISKGKGVKVWDTDGKQYIDCISGFSVANQGHCHPTIVKAMTEQASKLSIISRV 75
           Y PL L  + G G ++WD DG++Y+D ++G +V N GH HP +V A++EQA  L   S +
Sbjct: 10  YQPLALNFTHGLGTRLWDQDGREYLDAVAGVAVTNVGHSHPRLVAAISEQAGLLLHTSNL 69

Query: 76  LYSDNLGKWEEKICHLAKKDKVLPLNSGTEAVEAAIKIARKWGSEVKGITDGQVEIIAMN 135
              D   +  +K+  L+  ++    NSG EA E A+K+AR +G   KGI   Q  ++ M+
Sbjct: 70  YSIDWQQRLAQKLTQLSGMERAFFNNSGAEANETALKLARLYGWH-KGIE--QPLVVVMD 126

Query: 136 NNFHGRTLGSLSLSNHDAYKAGFHPLLQGTTTVDFGDI---EQLTQAISPNTAAIILEPI 192
           N FHGRTLG++S S+  + + G++ L      V FGD+   EQ+ QA +    A+++EPI
Sbjct: 127 NAFHGRTLGTMSASDGPSVRLGYNRLPGDFIKVPFGDLAALEQIQQAHAERIVAVLVEPI 186

Query: 193 QGEGGVNIPPKGYIQAVRQLCDKHQILLIADEIQVGLGRTGKWFAMEWEQVVPDIYILGK 252
           QGE GV + P GY++A+RQLC +   LL+ DEIQ G+GRTG+WFA + E +VPD+  L K
Sbjct: 187 QGESGVQLAPPGYLKALRQLCSRRAWLLMLDEIQTGIGRTGQWFAFQHEGIVPDVMTLAK 246

Query: 253 ALGGGLYPVSAVLANNDVMRVLTPGTHGSTFGGNPLAIAISTAALDVLKDEQLVERSERL 312
            LG G+ P+ A LA      + TPG+HGSTFGGNPLA  +    LD+++++ LV  +   
Sbjct: 247 GLGNGV-PIGACLARGKAAELFTPGSHGSTFGGNPLACRVGCTVLDIIEEQALVGNARHQ 305

Query: 313 GSFLLKALLQ--LKHPSIKEIRGRGLFIGIELNTDAAPFVDQLIQ-RGILCKDTHRTIIR 369
           G  LL  L     ++P++  IRG+GL IGIEL         +  +  G+L   T    IR
Sbjct: 306 GEQLLSRLRTELAENPNVLAIRGQGLMIGIELKQPVRDLTLRAARDHGLLINVTRGQTIR 365

Query: 370 LSPPLVIDKEEIHQIV 385
           L PPL ID  E+  IV
Sbjct: 366 LLPPLTIDGREVEMIV 381


Lambda     K      H
   0.319    0.137    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 370
Number of extensions: 16
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 394
Length of database: 391
Length adjustment: 31
Effective length of query: 363
Effective length of database: 360
Effective search space:   130680
Effective search space used:   130680
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory