GapMind for Amino acid biosynthesis

 

Alignments for a candidate for argC in Pseudomonas fluorescens FW300-N2C3

Align Probable N-acetyl-gamma-glutamyl-phosphate reductase, chloroplastic; AGPR; N-acetyl-glutamate semialdehyde dehydrogenase; NAGSA dehydrogenase; EC 1.2.1.38 (characterized)
to candidate AO356_14490 AO356_14490 N-acetyl-gamma-glutamyl-phosphate reductase

Query= SwissProt::Q93Z70
         (401 letters)



>FitnessBrowser__pseudo5_N2C3_1:AO356_14490
          Length = 344

 Score =  313 bits (801), Expect = 6e-90
 Identities = 163/345 (47%), Positives = 220/345 (63%), Gaps = 4/345 (1%)

Query: 59  IRIGLLGASGYTGAEIVRLLANHPHFQVTLMTADRKAGQSMESVFPHLRAQKLPTLVSVK 118
           +++G++G +GYTG E++RLLA HP  +V ++T+  +AG ++  ++P+LR        SV 
Sbjct: 2   VKVGIVGGTGYTGVELLRLLAQHPQAEVVVITSRSEAGLAVADMYPNLRGHYDGLAFSVP 61

Query: 119 DAD-FSTVDAVFCCLPHGTTQEIIKELPTA-LKIVDLSADFRLRNIAEYEEWYGQPHKAV 176
           D       D VF   PHG    +  EL  A  K++DLSADFRL++  E+ +WYGQPH A 
Sbjct: 62  DVKTLGACDVVFFATPHGVAHALAGELLAAGTKVIDLSADFRLQDADEWAKWYGQPHGAP 121

Query: 177 ELQKEVVYGLTEILREDIKKARLVANPGCYPTTIQLPLVPLLKANLIKHENIIIDAKSGV 236
           EL +E VYGL E+ RE IK+ARL+A PGCYPT  QL  +PLL+A L     +I D KSGV
Sbjct: 122 ELLEEAVYGLPEVNREKIKQARLIAVPGCYPTATQLGFLPLLEAGLADTSRLIADCKSGV 181

Query: 237 SGAGRGAKEANLYSEIAEGISSYGVTRHRHVPEIEQGLSDVAQSKVTVSFTPHLMPMIRG 296
           SGAGRGA   +LYSE +E + +Y V  HRH+PEI QGL   A   V ++F PHL PMIRG
Sbjct: 182 SGAGRGASVGSLYSETSESMKAYAVKGHRHLPEIRQGLRRAAGKDVGLTFVPHLTPMIRG 241

Query: 297 MQSTIYVEMAPGVRTEDLHQQLKTSYEDEEFVKVLDEGVVPRTHNVRGSNYCHMSVFPDR 356
           + ST+Y  +    R+ DL    +  Y +E FV V+  G  P T +VRG+N C ++V   +
Sbjct: 242 IHSTLYATVVD--RSVDLQALFEKRYANEPFVDVMPAGSHPETRSVRGANVCRIAVHRPQ 299

Query: 357 IPGRAIIISVIDNLVKGASGQALQNLNIMLGYPETTGLLHQPLFP 401
                +++SVIDNLVKGASGQA+QNLNI+ G  E  GL H  + P
Sbjct: 300 DGDLVVVLSVIDNLVKGASGQAVQNLNILFGLDERLGLSHAGMLP 344


Lambda     K      H
   0.318    0.134    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 408
Number of extensions: 12
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 401
Length of database: 344
Length adjustment: 30
Effective length of query: 371
Effective length of database: 314
Effective search space:   116494
Effective search space used:   116494
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 49 (23.5 bits)

Align candidate AO356_14490 AO356_14490 (N-acetyl-gamma-glutamyl-phosphate reductase)
to HMM TIGR01850 (argC: N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38))

Software error:

../bin/blast/fastacmd -i /tmp/list.25201.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.25201.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.