Align acetylornithine deacetylase (EC 3.5.1.16) (characterized)
to candidate AO356_25400 AO356_25400 acetylornithine deacetylase
Query= ecocyc::ACETYLORNDEACET-MONOMER (383 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_25400 Length = 389 Score = 200 bits (508), Expect = 6e-56 Identities = 135/381 (35%), Positives = 193/381 (50%), Gaps = 15/381 (3%) Query: 13 RALIATPSISATEEALDQSNADLITLLADWFKDLGFNVEVQPVPGTRNKFNMLASIGQGA 72 RAL+A AT SN LI + D+ + LG N E+ R K N+LASIG Sbjct: 7 RALLAELVSFATVSR--DSNLALIEFVRDYLQGLGVNSELI-YNAERTKANLLASIGPAL 63 Query: 73 -GGLLLAGHTDTVPFDDGRWTRDPFTLTEHDGKLYGLGTADMKGFFAFILDALRDVDVTK 131 GG++L+GHTD VP D WT +PF LTE DGK +G GTADMKG+ A +L A+ + Sbjct: 64 PGGVVLSGHTDVVPVDGQAWTVEPFCLTEMDGKWFGRGTADMKGYLASVLAAVPVFLSSP 123 Query: 132 LKKPLYILATADEETSMAGARYFAETTALR---PDCAIIGEPTSLQPVRAHKGHISNAIR 188 L++P+++ + DEE G R E R P +IGEPT LQPV HKG ++ Sbjct: 124 LRRPVHLAFSYDEEVGCLGVRSLLEVLPQRIAQPALCLIGEPTELQPVLGHKGKLAMRCH 183 Query: 189 IQGQSGHSSDPARGVNAIELMHDAIGHILQLRDNLKE-RYHYEAFTVPYPTLNLGHIHGG 247 ++G + HS+ GVNAIE IG + ++ L E H F + T+ +G +HGG Sbjct: 184 VKGAACHSAYAPYGVNAIEQAARLIGRLGEIGAQLAEPSRHDPRFDPAFSTVQVGVVHGG 243 Query: 248 DASNRICACCELHMDIRPLPG----MTLNELNGLLNDALAPVSERWPGRLTVD-ELHPPI 302 A N + A C ++R LP + +L G L P + G + E Sbjct: 244 TALNIVPADCRFDFEVRALPDFDPLVVAEQLQGYAEQTLLPAMQAVAGDTAIRFEPLSAY 303 Query: 303 PGYECPPNHQLVEVVEKLLGAKT-EVVNYCTEAP-FIQTLCPTLVLGPGSINQAHQPDEY 360 PG P+ ++V +L G+ V + TE F Q PT+V GPGS++Q H+PDEY Sbjct: 304 PGLATSPDSAAAQLVARLCGSDAFSTVAFGTEGGLFHQAGVPTVVCGPGSMDQGHKPDEY 363 Query: 361 LETRFIKPTRELITQVIHHFC 381 + + L+ ++ + C Sbjct: 364 VSVEQMAACDRLMDRLASYLC 384 Lambda K H 0.320 0.139 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 370 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 389 Length adjustment: 30 Effective length of query: 353 Effective length of database: 359 Effective search space: 126727 Effective search space used: 126727 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate AO356_25400 AO356_25400 (acetylornithine deacetylase)
to HMM TIGR01892 (argE: acetylornithine deacetylase (ArgE) (EC 3.5.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01892.hmm # target sequence database: /tmp/gapView.12229.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01892 [M=365] Accession: TIGR01892 Description: AcOrn-deacetyl: acetylornithine deacetylase (ArgE) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-125 405.2 0.0 1.4e-125 405.1 0.0 1.0 1 lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_25400 AO356_25400 acetylornithine deac Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_25400 AO356_25400 acetylornithine deacetylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 405.1 0.0 1.4e-125 1.4e-125 2 364 .. 9 379 .. 8 380 .. 0.97 Alignments for each domain: == domain 1 score: 405.1 bits; conditional E-value: 1.4e-125 TIGR01892 2 ilakLvafdsvsarsnvdlieyvedyleelgvavevlpvadgaeksnllaviGpkegagglvl 64 +la+Lv+f +vs+ sn++lie+v+dyl+ lgv+ e + +a+ +k nlla+iGp+ gg+vl lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_25400 9 LLAELVSFATVSRDSNLALIEFVRDYLQGLGVNSELIYNAER-TKANLLASIGPAL-PGGVVL 69 689*************************************99.************9.9***** PP TIGR01892 65 sGhtDvvPvdeaaWtsDpfrLtekdgrLYgrGtaDmkGFlalvLaavpdlaaakLkkPlhlvl 127 sGhtDvvPvd++aWt +pf Lte dg+ +grGtaDmkG+la vLaavp +L++P+hl++ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_25400 70 SGHTDVVPVDGQAWTVEPFCLTEMDGKWFGRGTADMKGYLASVLAAVPVFLSSPLRRPVHLAF 132 *************************************************************** PP TIGR01892 128 saDeevglaGakklieala...rrpalaivGePtslvavRahkGkasakvtvrGreghssrpd 187 s+Deevg++G+++l+e+l+ +pal ++GePt+l++v hkGk +++ +v+G hs+++ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_25400 133 SYDEEVGCLGVRSLLEVLPqriAQPALCLIGEPTELQPVLGHKGKLAMRCHVKGAACHSAYAP 195 ******************988889*************************************** PP TIGR01892 188 rGvsaielaakllarlvaladklkr.edleeaFtppyatlniGtvkGGkavniiaaaCelvle 249 Gv+aie+aa+l++rl + +l + + ++ F+p ++t+++G+v+GG+a ni++a C++ +e lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_25400 196 YGVNAIEQAARLIGRLGEIGAQLAEpSRHDPRFDPAFSTVQVGVVHGGTALNIVPADCRFDFE 258 ************************98999********************************** PP TIGR01892 250 lRpipGmdpeellallekiaee.....vkekapgfevkveelsatpaleleedaelvallekl 307 +R++p dp + ++l+ ae+ +++ a ++ ++ e lsa+p+l++ +d+ +++l+++l lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_25400 259 VRALPDFDPLVVAEQLQGYAEQtllpaMQAVAGDTAIRFEPLSAYPGLATSPDSAAAQLVARL 321 ****************99998877765555566677788999********************* PP TIGR01892 308 aGa.aaevvsygteagllqelGieavvlGPGdidqahqpdeYveieelkrcrallerl 364 G+ a +v++gte gl+ ++G+++vv+GPG++dq h+pdeYv +e++ +c+ l+ rl lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_25400 322 CGSdAFSTVAFGTEGGLFHQAGVPTVVCGPGSMDQGHKPDEYVSVEQMAACDRLMDRL 379 **9999*************************************************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (365 nodes) Target sequences: 1 (389 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.43 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory