Align glutamate 5-kinase (EC 2.7.2.11) (characterized)
to candidate AO356_15815 AO356_15815 gamma-glutamyl kinase
Query= BRENDA::P0A7B5 (367 letters) >lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_15815 AO356_15815 gamma-glutamyl kinase Length = 372 Score = 296 bits (759), Expect = 5e-85 Identities = 159/359 (44%), Positives = 226/359 (62%), Gaps = 1/359 (0%) Query: 8 VVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRIVIVTSGAIAAGREHLGYPELPA 67 VVK+G+++LT + L+R + V Q LH AG +V+V+SGA+AAG LG+ P+ Sbjct: 12 VVKIGSALLTADGKGLDRQAMAVWVEQMVALHEAGVELVLVSSGAVAAGMSRLGWTSRPS 71 Query: 68 TIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADMEDRERFLNARDTLRALLDN 127 + Q AA+GQ L+Q WE F+ +G H Q+LLT D+ DR+R+LNAR TLRAL++ Sbjct: 72 AMHELQAAAAIGQMGLVQAWESSFAEHGRHTAQILLTHDDLSDRKRYLNARSTLRALVEL 131 Query: 128 NIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQKGLYTADPRSNPQAEL 187 ++PVINEND V T EI+ GDND L+AL A L AD L++LTD+ G++ ADPR+NP A+L Sbjct: 132 KVIPVINENDTVVTDEIRFGDNDTLAALVANLVEADLLVILTDRDGMFDADPRNNPDAKL 191 Query: 188 IKDVYGIDDALRAIAGDSVSGLGTGGMSTKLQAADVACRAGIDTIIAAGSKPGVIGDVME 247 I + D AL A+AG + LG GGM TKL+AA +A R+G TII G V+ + Sbjct: 192 IYEARADDPALDAVAGGTGGALGRGGMQTKLRAARLAARSGAHTIIVGGRLERVLDRLKA 251 Query: 248 GISVGTLFHAQATPLENRKRWIFG-APPAGEITVDEGATAAILERGSSLLPKGIKSVTGN 306 G +GTL + L RK+W+ G G + +D GA +A+ + SLLP G+K V G+ Sbjct: 252 GERMGTLLSPERGMLAARKQWLAGHLQTRGTLVLDAGAVSALSQGNKSLLPVGVKLVQGS 311 Query: 307 FSRGEVIRICNLEGRDIAHGVSRYNSDALRRIAGHHSQEIDAILGYEYGPVAVHRDDMI 365 F RGE++ +GR+IA G++ Y++ ++I G S I +LGY P VHRD++I Sbjct: 312 FRRGEMVVCVAPDGREIARGLANYSALEAQKIIGQSSDAIVGLLGYMAEPELVHRDNLI 370 Lambda K H 0.318 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 369 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 372 Length adjustment: 30 Effective length of query: 337 Effective length of database: 342 Effective search space: 115254 Effective search space used: 115254 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate AO356_15815 AO356_15815 (gamma-glutamyl kinase)
to HMM TIGR01027 (proB: glutamate 5-kinase (EC 2.7.2.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01027.hmm # target sequence database: /tmp/gapView.5726.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01027 [M=363] Accession: TIGR01027 Description: proB: glutamate 5-kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.9e-135 436.3 0.3 5.6e-135 436.1 0.3 1.0 1 lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_15815 AO356_15815 gamma-glutamyl kinas Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_15815 AO356_15815 gamma-glutamyl kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 436.1 0.3 5.6e-135 5.6e-135 2 362 .. 10 370 .. 9 371 .. 0.99 Alignments for each domain: == domain 1 score: 436.1 bits; conditional E-value: 5.6e-135 TIGR01027 2 riVvKlGsssLteesgklkrsklaelveqvaklkkaGhevvivsSGavaaGleaLglperpkk 64 r VvK+Gs++Lt++ + l+r+ +a veq+ +l++aG e+v+vsSGavaaG+++Lg ++rp lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_15815 10 RWVVKIGSALLTADGKGLDRQAMAVWVEQMVALHEAGVELVLVSSGAVAAGMSRLGWTSRPSA 72 67************************************************************* PP TIGR01027 65 laekQalaaVGQgrLmklyeklfsqyglkvaQiLLtradlskrerylNarntleellelgvvp 127 ++e Qa+aa+GQ L++++e++f+++g+++aQiLLt++dls+r+rylNar+tl++l+el+v+p lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_15815 73 MHELQAAAAIGQMGLVQAWESSFAEHGRHTAQILLTHDDLSDRKRYLNARSTLRALVELKVIP 135 *************************************************************** PP TIGR01027 128 ivNENDtvaveeikfGDNDtLsalvaalveAdlLvlltdvdgLydadprtnpdAklieeveei 190 ++NENDtv ++ei+fGDNDtL+alva+lveAdlLv+ltd dg++dadpr+npdAkli e ++ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_15815 136 VINENDTVVTDEIRFGDNDTLAALVANLVEADLLVILTDRDGMFDADPRNNPDAKLIYEARAD 198 *************************************************************** PP TIGR01027 191 eeelkavagssgssvGTGGmrtKleaaelAsragveviiasgekpekiadlledaavgtlfea 253 + +l+avag++g ++G GGm+tKl aa+lA+r+g ++ii+ g+ + + +l +++ +gtl+ + lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_15815 199 DPALDAVAGGTGGALGRGGMQTKLRAARLAARSGAHTIIVGGRLERVLDRLKAGERMGTLLSP 261 ********************************************999**************** PP TIGR01027 254 kkkklknrkqwilaaseakGkiivdegaeeallekgksLlpagvvevegnFsrgevveilaee 316 ++ l +rkqw++ +++++G++++d+ga++al++ +ksLlp+gv v+g+F+rge+v ++a++ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_15815 262 ERGMLAARKQWLAGHLQTRGTLVLDAGAVSALSQGNKSLLPVGVKLVQGSFRRGEMVVCVAPD 324 *************************************************************** PP TIGR01027 317 gqeigkglvnysseelekikglkseeiedvLgyekkeevvhrdnlv 362 g+ei++gl+nys+ e +ki g++s+ i +Lgy + e vhrdnl+ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_15815 325 GREIARGLANYSALEAQKIIGQSSDAIVGLLGYMAEPELVHRDNLI 370 ********************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (363 nodes) Target sequences: 1 (372 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 6.72 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory