GapMind for Amino acid biosynthesis

 

Alignments for a candidate for proC in Pseudomonas fluorescens FW300-N2C3

Align Pyrroline-5-carboxylate reductase; P5C reductase; P5CR; PCA reductase; EC 1.5.1.2 (characterized)
to candidate AO356_13420 AO356_13420 pyrroline-5-carboxylate reductase

Query= SwissProt::P22008
         (273 letters)



>FitnessBrowser__pseudo5_N2C3_1:AO356_13420
          Length = 272

 Score =  385 bits (988), Expect = e-112
 Identities = 200/273 (73%), Positives = 233/273 (85%), Gaps = 1/273 (0%)

Query: 1   MSTPRIAFIGAGNMAASLIGGLRAQGVPAAQIRASDPGAEQRAKIAGEFAIDVVESNAEA 60
           MS  RIAFIGAGNMAASLIGGLRA+G+ A+ IRASDPG E R +++ E  I+    NA+A
Sbjct: 1   MSNTRIAFIGAGNMAASLIGGLRAKGLDASLIRASDPGEETRTRVSAEHGIETFADNAQA 60

Query: 61  VADADVVVLSVKPQAMKAVCQALAPALKPEQLIVSIAAGIPCASLEAWLGQPRPVVRCMP 120
           +  ADV+VL+VKPQAMK VC+AL P+LKP QL+VSIAAGI CAS+  WLG+ +P+VRCMP
Sbjct: 61  IDGADVIVLAVKPQAMKTVCEALRPSLKPHQLVVSIAAGITCASMNNWLGE-QPIVRCMP 119

Query: 121 NTPALLRQGASGLYANAQVSAAQCEQAGQLLSAVGIALWLDDEAQIDAVTAVSGSGPAYF 180
           NTPALLRQG SGL+A   VSA Q +QA  LLSAVG+ALWLD E Q+DAVTAVSGSGPAYF
Sbjct: 120 NTPALLRQGVSGLFATPHVSAEQRQQAETLLSAVGLALWLDTEQQLDAVTAVSGSGPAYF 179

Query: 181 FLLMQAMTDAGEKLGLSRETASRLTLQTALGAAQMALSSEVEPAELRRRVTSPNGTTEAA 240
           FLL++AMT AGEKLGL+RETA++LTLQTALGAA MA+SS+V+ AELRRRVTSP GTTEAA
Sbjct: 180 FLLIEAMTAAGEKLGLTRETAAQLTLQTALGAAHMAVSSDVDAAELRRRVTSPAGTTEAA 239

Query: 241 IKSFQANGFEALVEQALNAASQRSAELAEQLGQ 273
           IKSFQA GFEALVE+AL AA+ RSAE+AEQLGQ
Sbjct: 240 IKSFQAGGFEALVEKALGAAAHRSAEMAEQLGQ 272


Lambda     K      H
   0.315    0.127    0.348 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 269
Number of extensions: 6
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 273
Length of database: 272
Length adjustment: 25
Effective length of query: 248
Effective length of database: 247
Effective search space:    61256
Effective search space used:    61256
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 47 (22.7 bits)

Align candidate AO356_13420 AO356_13420 (pyrroline-5-carboxylate reductase)
to HMM TIGR00112 (proC: pyrroline-5-carboxylate reductase (EC 1.5.1.2))

Software error:

../bin/blast/fastacmd -i /tmp/list.15370.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.15370.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.