Align Pyrroline-5-carboxylate reductase; P5C reductase; P5CR; PCA reductase; EC 1.5.1.2 (characterized)
to candidate AO356_13420 AO356_13420 pyrroline-5-carboxylate reductase
Query= SwissProt::P22008 (273 letters) >lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_13420 AO356_13420 pyrroline-5-carboxylate reductase Length = 272 Score = 385 bits (988), Expect = e-112 Identities = 200/273 (73%), Positives = 233/273 (85%), Gaps = 1/273 (0%) Query: 1 MSTPRIAFIGAGNMAASLIGGLRAQGVPAAQIRASDPGAEQRAKIAGEFAIDVVESNAEA 60 MS RIAFIGAGNMAASLIGGLRA+G+ A+ IRASDPG E R +++ E I+ NA+A Sbjct: 1 MSNTRIAFIGAGNMAASLIGGLRAKGLDASLIRASDPGEETRTRVSAEHGIETFADNAQA 60 Query: 61 VADADVVVLSVKPQAMKAVCQALAPALKPEQLIVSIAAGIPCASLEAWLGQPRPVVRCMP 120 + ADV+VL+VKPQAMK VC+AL P+LKP QL+VSIAAGI CAS+ WLG+ +P+VRCMP Sbjct: 61 IDGADVIVLAVKPQAMKTVCEALRPSLKPHQLVVSIAAGITCASMNNWLGE-QPIVRCMP 119 Query: 121 NTPALLRQGASGLYANAQVSAAQCEQAGQLLSAVGIALWLDDEAQIDAVTAVSGSGPAYF 180 NTPALLRQG SGL+A VSA Q +QA LLSAVG+ALWLD E Q+DAVTAVSGSGPAYF Sbjct: 120 NTPALLRQGVSGLFATPHVSAEQRQQAETLLSAVGLALWLDTEQQLDAVTAVSGSGPAYF 179 Query: 181 FLLMQAMTDAGEKLGLSRETASRLTLQTALGAAQMALSSEVEPAELRRRVTSPNGTTEAA 240 FLL++AMT AGEKLGL+RETA++LTLQTALGAA MA+SS+V+ AELRRRVTSP GTTEAA Sbjct: 180 FLLIEAMTAAGEKLGLTRETAAQLTLQTALGAAHMAVSSDVDAAELRRRVTSPAGTTEAA 239 Query: 241 IKSFQANGFEALVEQALNAASQRSAELAEQLGQ 273 IKSFQA GFEALVE+AL AA+ RSAE+AEQLGQ Sbjct: 240 IKSFQAGGFEALVEKALGAAAHRSAEMAEQLGQ 272 Lambda K H 0.315 0.127 0.348 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 269 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 272 Length adjustment: 25 Effective length of query: 248 Effective length of database: 247 Effective search space: 61256 Effective search space used: 61256 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
Align candidate AO356_13420 AO356_13420 (pyrroline-5-carboxylate reductase)
to HMM TIGR00112 (proC: pyrroline-5-carboxylate reductase (EC 1.5.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00112.hmm # target sequence database: /tmp/gapView.32450.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00112 [M=263] Accession: TIGR00112 Description: proC: pyrroline-5-carboxylate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.5e-81 257.8 6.2 7.4e-81 257.6 6.2 1.0 1 lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_13420 AO356_13420 pyrroline-5-carboxyl Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_13420 AO356_13420 pyrroline-5-carboxylate reductase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 257.6 6.2 7.4e-81 7.4e-81 1 263 [] 6 266 .. 6 266 .. 0.97 Alignments for each domain: == domain 1 score: 257.6 bits; conditional E-value: 7.4e-81 TIGR00112 1 iaiiGaGnmgeallsgllkkgakakkeilvierseeklaalakelgvevtsdaeeavkeadvv 63 ia+iGaGnm+++l+ gl +kg ++ i ++ ee +++ +e g+e+ +d+++a++ adv+ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_13420 6 IAFIGAGNMAASLIGGLRAKGLD-ASLIRASDPGEETRTRVSAEHGIETFADNAQAIDGADVI 67 89**************9999765.7888888889***************************** PP TIGR00112 64 llavKPqdleevlaelkseektkeklliSilAGvtiekleqlleaekrvvRvmPNtaakvgag 126 +lavKPq +++v++ l+ + + ++l++Si+AG+t++ ++++l+ e+++vR+mPNt+a +++g lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_13420 68 VLAVKPQAMKTVCEALRP-SLKPHQLVVSIAAGITCASMNNWLG-EQPIVRCMPNTPALLRQG 128 *****************9.6669********************7.699*************** PP TIGR00112 127 vtaiaassevseeqkelveellkavGkvveve.eklldavtalsGSgPAfvflliealadagv 188 v++++a+ +vs+eq++++e ll+avG +++++ e++ldavta+sGSgPA++flliea+ +ag lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_13420 129 VSGLFATPHVSAEQRQQAETLLSAVGLALWLDtEQQLDAVTAVSGSGPAYFFLLIEAMTAAGE 191 *************************************************************** PP TIGR00112 189 klGLpreeakelaaqtlkGaaklleesgehpalLkdkVtsPgGtTiaglavLeekgvrsavie 251 klGL+re+a +l+ qt Gaa++ s+ ++a+L+ +VtsP+GtT a++++++++g+++ v++ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_13420 192 KLGLTRETAAQLTLQTALGAAHMAVSSDVDAAELRRRVTSPAGTTEAAIKSFQAGGFEALVEK 254 *************************************************************** PP TIGR00112 252 aveaavkrseeL 263 a+ aa++rs e+ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_13420 255 ALGAAAHRSAEM 266 ********9885 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (263 nodes) Target sequences: 1 (272 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 7.54 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory