Align Threonine synthase; TS; EC 4.2.3.1 (uncharacterized)
to candidate AO356_27150 AO356_27150 threonine synthase
Query= curated2:P29363 (469 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_27150 Length = 467 Score = 400 bits (1027), Expect = e-116 Identities = 201/465 (43%), Positives = 292/465 (62%), Gaps = 16/465 (3%) Query: 1 MRYISTRGQAPALNFEDVLLAGLASDGGLYVPENLPRFTLEEIASWVGLPYHELAFRVMR 60 M+Y+STR F +VL+ A DGGLYVP +PRF EE++ LP+HELA V+ Sbjct: 1 MKYVSTRTPGRTFEFSEVLMGSYAPDGGLYVPRKVPRFKKEELSKLEWLPFHELARHVIE 60 Query: 61 PFVAGSIADADFKKILEETYGVFAHDAVAPLRQLNGNEWVLELFHGPTLAFKDFALQLLG 120 PF+ G + ++LE+T+ F ++AVAPL Q NEW+LELFHGP+ A++DF LQL+ Sbjct: 61 PFLGGWVEQDQLSRMLEDTFDCFTNNAVAPLYQTASNEWLLELFHGPSGAYQDFGLQLMS 120 Query: 121 RLLDHVLAKRGERVVIMGATSGDTGSAAIEGCRRCDNVDIFIMHPHNRVSEVQRRQMTTI 180 R ++H L K G++ +I+G T GDTG+AAI+ V + ++HP ++ RR++ ++ Sbjct: 121 RFINHDLLKSGKKALIVGCTGGDTGAAAIKAFSGMTGVTLLVLHPSKELTAEDRRRLLSV 180 Query: 181 LGDNIHNIAIEGNFDDCQEMVKASFADQGFLKGTRLVAVNSINWARIMAQIVYYFHAALQ 240 N+ NI I G++ DC + + F Q LV+ NS++W R++A + +YF++ALQ Sbjct: 181 EEGNVINIEIAGDYSDCHRLCE-QFLKQNNDAQQHLVSFNSVHWVRVLAHLSFYFYSALQ 239 Query: 241 LGAPHRSVAFSVPTGNFGDIFAGYLARNMGLPVSQLIVATNRNDILHRFMSGNRYDKDTL 300 LGAP R VAFSVPTGNFG ++AGY+A+ MGLP+ QLIVATN N LH F+ N Y ++ + Sbjct: 240 LGAPKRQVAFSVPTGNFGALYAGYIAKQMGLPIRQLIVATNANAGLHHFLQSNLYSRNEI 299 Query: 301 HPSLSPSMDIMVSSNFERLLFDLHGRNGKAVAELLDAFKASGKLSVEDQRWTEARKLFDS 360 + +P+M++ ++SNFERL + + R G+ VA + + G + +E W EARKLFDS Sbjct: 300 RTTKTPTMNVSLASNFERLQWSILNRCGEKVARNMQLLEGEGTIHLEQDEWLEARKLFDS 359 Query: 361 LAVSDEQTCETIAEVYRSSGELLDPHTAIGVRAARECRRSLSVPMVTLGTAHPVKFPEAV 420 LAV D I EV+ SG L+ P+TAIG+RAAR RRSL +PM++L T HP K A Sbjct: 360 LAVDDADAFSCIHEVFAQSGYLVSPNTAIGLRAARVSRRSLLIPMISLATTHPSKIGAAT 419 Query: 421 EKAGI------GQAPALPAHLADLFEREERCTVLPNELAKVQAFV 459 +K+ I G APA E+ CT +PN++ + + V Sbjct: 420 DKSEIFGHLNTGGAPA---------STEQDCTSIPNDIGALTSLV 455 Lambda K H 0.322 0.137 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 541 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 469 Length of database: 467 Length adjustment: 33 Effective length of query: 436 Effective length of database: 434 Effective search space: 189224 Effective search space used: 189224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
Align candidate AO356_27150 AO356_27150 (threonine synthase)
to HMM TIGR00260 (thrC: threonine synthase (EC 4.2.3.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00260.hmm # target sequence database: /tmp/gapView.6881.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00260 [M=340] Accession: TIGR00260 Description: thrC: threonine synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.8e-56 175.4 0.0 1.1e-55 175.1 0.0 1.0 1 lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_27150 AO356_27150 threonine synthase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_27150 AO356_27150 threonine synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 175.1 0.0 1.1e-55 1.1e-55 26 309 .. 83 395 .. 62 426 .. 0.84 Alignments for each domain: == domain 1 score: 175.1 bits; conditional E-value: 1.1e-55 TIGR00260 26 frspklaeevga..enlyvkelfhgPtlaFKDrglqfvavlltk..alelgnetvlcAtsGdt 84 f+++++ +++ + n +++elfhgP++a+ D+glq ++ +++ ++ +++++++ t Gdt lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_27150 83 FTNNAV-APLYQtaSNEWLLELFHGPSGAYQDFGLQLMSRFINHdlLKSGKKALIVGCTGGDT 144 333333.344333578899***********************975456667779********* PP TIGR00260 85 gaaaaealagkanvkvvvLyPkgkispv.keklvtalaenakvlaikGdFDdaqdlvkeife. 145 gaaa++a++g+ +v +vL P+ ++ +l+ + +n+ ++i Gd+ d+ +l+++ ++ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_27150 145 GAAAIKAFSGMTGVTLLVLHPSKELTAEdRRRLLSVEEGNVINIEIAGDYSDCHRLCEQFLKq 207 ***********************99977899*******************************5 PP TIGR00260 146 .dkeklklnsvNsinparieaqk.tyafeiveqlgkespdkvvvpvpsgnfgailkGflekke 206 ++ + l+s Ns+ + r++a y+++++ qlg + +v+++vp gnfga+++G+ +k++ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_27150 208 nNDAQQHLVSFNSVHWVRVLAHLsFYFYSAL-QLG-APKRQVAFSVPTGNFGALYAGYIAKQM 268 5555999****************55555555.667.68899****************999999 PP TIGR00260 207 lglpieklaiaaegaadivrrflksgdlepkedk.eTlstAmdignpsnverale.larrslg 267 + lpi+ l +a++ + +++fl+s l+ +++ T + m+++ sn+er+ + + +r ++ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_27150 269 G-LPIRQLIVATNAN-AGLHHFLQSN-LYSRNEIrTTKTPTMNVSLASNFERLQWsILNRCGE 328 9.**99999888887.99*****999.666666659999****************86666665 PP TIGR00260 268 nledlke.........................svsdeeileaikklaeeegyllephtavava 305 ++ + +v d++ + i+++ ++ gyl+ p ta++++ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_27150 329 KVARNMQllegegtihleqdewlearklfdslAVDDADAFSCIHEVFAQSGYLVSPNTAIGLR 391 55444345667***************************************************9 PP TIGR00260 306 alkk 309 a + lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_27150 392 AARV 395 9764 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (340 nodes) Target sequences: 1 (467 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 12.86 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory