Align Tryptophan synthase beta chain 1; EC 4.2.1.20 (characterized, see rationale)
to candidate AO356_10915 AO356_10915 tryptophan synthase subunit beta
Query= uniprot:P50383 (425 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_10915 Length = 410 Score = 132 bits (332), Expect = 2e-35 Identities = 111/372 (29%), Positives = 166/372 (44%), Gaps = 54/372 (14%) Query: 72 IGRPTPLFRAKRLEEYLKTPARIYFKYEGATPTGSHKINTAIPQAYFAKEEGIEHVVTET 131 +GRP+PL+ A+RL EY A+IY K E TG+HKIN I Q A+ G + ++ ET Sbjct: 64 VGRPSPLYFAERLTEYCGG-AKIYLKREELNHTGAHKINNCIGQILLARRMGKKRIIAET 122 Query: 132 GAGQWGTAVALAASMYNMKSTIFMVKVSYEQKPMRRSIMQLYGANVYASPTNLTEYGRKI 191 GAG G A A A+ + + I+M E++ M+L GA V Sbjct: 123 GAGMHGVATATVAARFGLDCVIYMGTTDIERQQANVFRMKLLGAEVIPVVAG-------- 174 Query: 192 LETNPQHPGSLGIAMSEAIEYALKN--EFRYLVGSVLD------VVLLHQSVIGQETITQ 243 G+L AM+EA+ + N YL+G+V +V Q+VIG+ET Q Sbjct: 175 -------TGTLKDAMNEALRDWVTNVDSTFYLIGTVAGPHPYPAMVRDFQAVIGKETRDQ 227 Query: 244 LDLL-GEDADILIGCVGGGSNFGGFTYPFIGNKKGK--------------RYIAVSSAEI 288 L G D L+ C+GGGSN G +PF+ +K + ++ A + + Sbjct: 228 LQAQEGRLPDSLVACIGGGSNAMGLFHPFLDDKSVEIIGVEAAGYGIETGKHAASLNGGV 287 Query: 289 PKFSKGEYKYDFPDSAGLLPLVKMITLGKDYVPPPIYAGGLRYHGVAPTLSLLTKEGIVE 348 P G + D G + + + GL Y G+ P + L G V+ Sbjct: 288 PGVLHGNRTFLLQDDDGQI------------IDAHSISAGLDYPGIGPEHAWLHDIGRVQ 335 Query: 349 WREYNEREIFEAAKIFIENQGIVPAPESAHAIRAVVDEAIEARKNNERKVIVFNLSGHGL 408 + + E EA +GI+PA ESAHA+ V A K++ ++V NLSG G Sbjct: 336 YTSVTDAEALEAFHKCCRLEGIIPALESAHALAEVFKRAPNLPKDH---LMVVNLSGRGD 392 Query: 409 LDLSNYESMMKR 420 D+ M++ Sbjct: 393 KDMQTVMHHMEQ 404 Lambda K H 0.318 0.138 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 387 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 410 Length adjustment: 32 Effective length of query: 393 Effective length of database: 378 Effective search space: 148554 Effective search space used: 148554 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate AO356_10915 AO356_10915 (tryptophan synthase subunit beta)
to HMM TIGR00263 (trpB: tryptophan synthase, beta subunit (EC 4.2.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00263.hmm # target sequence database: /tmp/gapView.10634.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00263 [M=385] Accession: TIGR00263 Description: trpB: tryptophan synthase, beta subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-197 641.3 0.0 3.3e-197 641.1 0.0 1.0 1 lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_10915 AO356_10915 tryptophan synthase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_10915 AO356_10915 tryptophan synthase subunit beta # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 641.1 0.0 3.3e-197 3.3e-197 1 384 [. 18 401 .. 18 402 .. 0.99 Alignments for each domain: == domain 1 score: 641.1 bits; conditional E-value: 3.3e-197 TIGR00263 1 gkfgefGGqyvpevllealeelekayekakkdeefkkeleellkeyagrptpltfaknlskkl 63 g fg+fGG+yv+e+l++ + +l ++ye ak+d++f +el ++ ++y+grp+pl+fa++l++ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_10915 18 GLFGAFGGRYVAETLMPLILDLAREYEVAKEDPAFIEELAYFQRDYVGRPSPLYFAERLTEYC 80 67************************************************************* PP TIGR00263 64 ggakiylkredllhtGahkinnalgqallakrlGkkriiaetGaGqhGvatataaallglece 126 ggakiylkre+l+htGahkinn +gq+lla+r+GkkriiaetGaG hGvatat+aa++gl+c+ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_10915 81 GGAKIYLKREELNHTGAHKINNCIGQILLARRMGKKRIIAETGAGMHGVATATVAARFGLDCV 143 *************************************************************** PP TIGR00263 127 vymGaedverqklnvfrmellgakvvpvtsGsktlkdavnealrdWvtsvedthyvlGsavGp 189 +ymG++d+erq+ nvfrm+llga+v+pv G+ tlkda+nealrdWvt+v++t+y++G+++Gp lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_10915 144 IYMGTTDIERQQANVFRMKLLGAEVIPVVAGTGTLKDAMNEALRDWVTNVDSTFYLIGTVAGP 206 *************************************************************** PP TIGR00263 190 hPfPeivrefqsvigeevkeqilekegrlPdaviacvGGGsnaiGifaafiedeeveligvea 252 hP+P++vr+fq+vig+e++ q++++egrlPd ++ac+GGGsna+G+f++f++d++ve+igvea lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_10915 207 HPYPAMVRDFQAVIGKETRDQLQAQEGRLPDSLVACIGGGSNAMGLFHPFLDDKSVEIIGVEA 269 *************************************************************** PP TIGR00263 253 gGkGidtekhaatlskGkeGvlhGaktkllqdedGqieeahsvsaGldypgvgPehaalaetg 315 +G Gi+t khaa+l+ G +GvlhG++t llqd+dGqi +ahs+saGldypg+gPeha+l+++g lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_10915 270 AGYGIETGKHAASLNGGVPGVLHGNRTFLLQDDDGQIIDAHSISAGLDYPGIGPEHAWLHDIG 332 *************************************************************** PP TIGR00263 316 raeyeaitdeealealkllskeeGiipalesshalaaleklapklkkdeivvvnlsGrGdkdl 378 r++y+++td+ealea++++++ eGiipales+hala + k ap+l+kd+++vvnlsGrGdkd+ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_10915 333 RVQYTSVTDAEALEAFHKCCRLEGIIPALESAHALAEVFKRAPNLPKDHLMVVNLSGRGDKDM 395 *************************************************************** PP TIGR00263 379 etvaka 384 +tv+++ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_10915 396 QTVMHH 401 ***986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (410 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.54 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory