Align Acetylornithine deacetylase; AO; Acetylornithinase; EC 3.5.1.16; N-acetylornithinase; NAO (uncharacterized)
to candidate Pf6N2E2_367 Acetylornithine deacetylase (EC 3.5.1.16)
Query= curated2:B1LNR7 (383 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_367 Length = 385 Score = 169 bits (427), Expect = 2e-46 Identities = 131/371 (35%), Positives = 186/371 (50%), Gaps = 22/371 (5%) Query: 6 PPFIEIYRALIATPSISATEEALDQSNADLITLLADWFKDLGF-NVEVQPVPGTRNKFNM 64 P + I+ L+A ++S+ +SN LI + + G ++ V+ G K N+ Sbjct: 3 PRVLAIFERLLAFETVSS------ESNLALIEYVRELLLSKGIESLIVKDESG--KKANL 54 Query: 65 LASTG-QGAGGLLLAGHTDTVPFDDGRWTRDPFTLTEHDGKLYGLGTADMKGFFAFILDA 123 ASTG + G+LL+GHTD VP WT F T DG++YG G+ DMKGF A +DA Sbjct: 55 FASTGPRDLPGVLLSGHTDVVPAAGQAWTVPAFQATVRDGRVYGRGSCDMKGFIALAIDA 114 Query: 124 LRDVDVTKLAKPLYILATADEETSMAGARYFAETTAL---RPDCAIIGEPTSLQPVRAHK 180 + D L +PL + + DEE G R + L RP +IGEPT++Q V HK Sbjct: 115 MLDAADHSLNRPLQLALSHDEEIGCVGVRRLLDVLHLAPVRPFLCVIGEPTNMQFVLGHK 174 Query: 181 GHISNAIRIQGQSGHSSDPARGVNAIELMHDAIGHILQLRDKLKERYHYEA-FTVPYPTL 239 G S +G HSS R VNAI + D I + Q + +L+E+ +A + VPY T+ Sbjct: 175 GKGSYRTYCRGLEAHSSLAPRSVNAIHVACDFIAALRQSQQQLQEQGAQDADYDVPYSTV 234 Query: 240 NLGHIHGGDASNRICACCELHMDIRPLPGMTLN-ELNGLLNDALAPVSERWPGRLTVD-- 296 ++G I GG A N + C L ++R LP L+ L L A V E D Sbjct: 235 HVGQIVGGKALNIVPNLCTLDFEVRNLPDDDLDLFLEQLRERAEVIVREAKKLSSVADIE 294 Query: 297 -ELHPPIPGYECPPNHQLVEVVEKLL--GAKTEVVNYCTEAP-FIQTL-CPTLVLGPGSI 351 E PG + P+ + V ++ G T V++ TE F Q L P +V GPGSI Sbjct: 295 IETLNVYPGLDTHPSVEAVRFLKNFATPGTGTAKVSFGTEGGLFKQRLDVPVVVCGPGSI 354 Query: 352 NQAHQPDEYLE 362 QAH+PDE++E Sbjct: 355 EQAHKPDEFIE 365 Lambda K H 0.320 0.138 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 353 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 385 Length adjustment: 30 Effective length of query: 353 Effective length of database: 355 Effective search space: 125315 Effective search space used: 125315 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate Pf6N2E2_367 (Acetylornithine deacetylase (EC 3.5.1.16))
to HMM TIGR01892 (argE: acetylornithine deacetylase (ArgE) (EC 3.5.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01892.hmm # target sequence database: /tmp/gapView.12276.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01892 [M=365] Accession: TIGR01892 Description: AcOrn-deacetyl: acetylornithine deacetylase (ArgE) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.6e-111 356.4 0.0 9.7e-111 356.3 0.0 1.0 1 lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_367 Acetylornithine deacetylase (EC Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_367 Acetylornithine deacetylase (EC 3.5.1.16) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 356.3 0.0 9.7e-111 9.7e-111 2 363 .. 8 378 .. 7 380 .. 0.95 Alignments for each domain: == domain 1 score: 356.3 bits; conditional E-value: 9.7e-111 TIGR01892 2 ilakLvafdsvsarsnvdlieyvedyleelgvavevlpvadgaeksnllaviGpkegagglvlsG 66 i+++L+af++vs sn++lieyv++ l ++g++ ++ g +k nl+a+ Gp++ g++lsG lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_367 8 IFERLLAFETVSSESNLALIEYVRELLLSKGIESLIVKDESG-KKANLFASTGPRD-LPGVLLSG 70 899**********************************99999.9***********9.9******* PP TIGR01892 67 htDvvPvdeaaWtsDpfrLtekdgrLYgrGtaDmkGFlalvLaavpdlaaakLkkPlhlvlsaDe 131 htDvvP++++aWt +f+ t++dgr+YgrG++DmkGF+al+++a+ d a + L +Pl l+ls De lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_367 71 HTDVVPAAGQAWTVPAFQATVRDGRVYGRGSCDMKGFIALAIDAMLDAADHSLNRPLQLALSHDE 135 ***************************************************************** PP TIGR01892 132 evglaGakklieala...rrpalaivGePtslvavRahkGkasakvtvrGreghssrpdrGvsai 193 e+g+ G+++l+++l rp l ++GePt+++ v hkGk s + rG e+hss + r v+ai lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_367 136 EIGCVGVRRLLDVLHlapVRPFLCVIGEPTNMQFVLGHKGKGSYRTYCRGLEAHSSLAPRSVNAI 200 ************9987889********************************************** PP TIGR01892 194 elaakllarlvaladklkr.edleeaFtppyatlniGtvkGGkavniiaaaCelvlelRpipGmd 257 ++a +++a l + +++l++ + ++ +++py+t+++G++ GGka ni+++ C l +e+R +p d lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_367 201 HVACDFIAALRQSQQQLQEqGAQDADYDVPYSTVHVGQIVGGKALNIVPNLCTLDFEVRNLPDDD 265 *****************996778889*************************************** PP TIGR01892 258 peellallekiaeevkekapg....fevkveelsatpaleleedaelvallekla..Gaaaevvs 316 ++ l++l++ ae ++++a + ++++e+l+ +p+l++++ e+v++l++ a G + vs lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_367 266 LDLFLEQLRERAEVIVREAKKlssvADIEIETLNVYPGLDTHPSVEAVRFLKNFAtpGTGTAKVS 330 ********999998776654411115678999********************98744779999** PP TIGR01892 317 ygteagll.qelGieavvlGPGdidqahqpdeYveieelkrcraller 363 +gte gl+ q+l ++ vv+GPG+i+qah+pde++ei+++ +++ +le lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_367 331 FGTEGGLFkQRLDVPVVVCGPGSIEQAHKPDEFIEISQMDAGERFLEG 378 ******996789*******************************99975 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (365 nodes) Target sequences: 1 (385 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 12.45 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory