Align Argininosuccinate synthase; Citrulline--aspartate ligase; EC 6.3.4.5 (characterized)
to candidate Pf6N2E2_5590 Argininosuccinate synthase (EC 6.3.4.5)
Query= SwissProt::P59846 (400 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5590 Length = 405 Score = 508 bits (1308), Expect = e-148 Identities = 251/393 (63%), Positives = 302/393 (76%), Gaps = 3/393 (0%) Query: 2 KIVLAYSGGLDTSIILKWLKETYRAEVIAFTADIGQGEEVEEAREKALRTGASKAIALDL 61 K+VLAYSGGLDTS+ILKWL++TY EV+ FTAD+GQGEEVE AR KA G + DL Sbjct: 6 KVVLAYSGGLDTSVILKWLQDTYNCEVVTFTADLGQGEEVEPARAKAQAMGVKEIYIDDL 65 Query: 62 KEEFVRDFVFPMMRAGAVYEGYYLLGTSIARPLIAKHLVRIAEEEGAEAIAHGATGKGND 121 +EEFVRDFVFPM RA VYEG YLLGTSIARPLIAK L+ IA E GA+AI+HGATGKGND Sbjct: 66 REEFVRDFVFPMFRANTVYEGEYLLGTSIARPLIAKRLIEIANETGADAISHGATGKGND 125 Query: 122 QVRFELTAYALKPDIKVIAPWREWSFQGRKEMIAYAEAHGIPVPVTQEK--PYSMDANLL 179 QVRFEL AYALKP +KVIAPWREW R++++ YAE H IP+ +K PYSMDANLL Sbjct: 126 QVRFELGAYALKPGVKVIAPWREWDLLSREKLMDYAEKHAIPIERHGKKKSPYSMDANLL 185 Query: 180 HISYEGGVLEDPWAEPPKGMFRMTQDPEEAPDAPEYVEVEFFEGDPVAVNGERLSPAALL 239 HISYEGGVLED W E + M+R T PE+APD P+Y+E+ + GD VA++G +SPA +L Sbjct: 186 HISYEGGVLEDTWTEHEEDMWRWTVSPEKAPDTPQYLELTYRNGDIVALDGVEMSPATVL 245 Query: 240 QRLNEIGGRHGVGRVDIVENRFVGMKSRGVYETPGGTILYHARRAVESLTLDREVLHQRD 299 LN IGG HG+GR+DIVENR+VGMKSRG YETPGGTI+ A RA+ES+TLDREV H +D Sbjct: 246 ATLNRIGGEHGIGRLDIVENRYVGMKSRGCYETPGGTIMLRAHRAIESITLDREVAHLKD 305 Query: 300 MLSPKYAELVYYGFWYAPEREALQAYFDHVARSVTGVARLKLYKGNVYVVGRKAPKSLYR 359 L PKYA L+Y G+W++PER LQ D V GV RLKLYKGNV V GRK+ +SL+ Sbjct: 306 ELMPKYASLIYTGYWWSPERLMLQQMIDASQAHVNGVVRLKLYKGNVIVTGRKSDESLFD 365 Query: 360 QDLVSFDEAGG-YDQKDAEGFIKIQALRLRVRA 391 ++ +F+E GG Y+Q DA GFIK+ ALR+R+ A Sbjct: 366 ANIATFEEDGGAYNQADAAGFIKLNALRMRIAA 398 Lambda K H 0.319 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 506 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 405 Length adjustment: 31 Effective length of query: 369 Effective length of database: 374 Effective search space: 138006 Effective search space used: 138006 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate Pf6N2E2_5590 (Argininosuccinate synthase (EC 6.3.4.5))
to HMM TIGR00032 (argG: argininosuccinate synthase (EC 6.3.4.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00032.hmm # target sequence database: /tmp/gapView.29116.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00032 [M=394] Accession: TIGR00032 Description: argG: argininosuccinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-146 474.5 0.0 2e-146 474.3 0.0 1.0 1 lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5590 Argininosuccinate synthase (EC 6 Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5590 Argininosuccinate synthase (EC 6.3.4.5) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 474.3 0.0 2e-146 2e-146 1 391 [. 6 399 .. 6 402 .. 0.97 Alignments for each domain: == domain 1 score: 474.3 bits; conditional E-value: 2e-146 TIGR00032 1 kvvlaysGGlDtsvalklleek.gaeviavtvdvGqpeedldaieekalklGaekayviDaree 63 kvvlaysGGlDtsv+lk+l++ ++ev+++t+d+Gq+ e+++ ++ ka ++G+++ y+ D ree lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5590 6 KVVLAYSGGLDTSVILKWLQDTyNCEVVTFTADLGQG-EEVEPARAKAQAMGVKEIYIDDLREE 68 8*********************99************9.9************************* PP TIGR00032 64 fvkdylfaaiqanavyegkYllstaLaRpliakklvevakkegaeavahGctgKGnDqvRFels 127 fv+d++f+ +an+vyeg+Yll+t++aRpliak+l+e+a++ ga+a++hG+tgKGnDqvRFel lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5590 69 FVRDFVFPMFRANTVYEGEYLLGTSIARPLIAKRLIEIANETGADAISHGATGKGNDQVRFELG 132 **************************************************************** PP TIGR00032 128 illlnpdlkviaPvreleli.ReeeieyaaekGievpv..ekekaysiDenllgrsiEageLEd 188 ++l+p +kviaP+re++l Re++++ya+++ i+++ +k+++ys+D nll++s+E+g LEd lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5590 133 AYALKPGVKVIAPWREWDLLsREKLMDYAEKHAIPIERhgKKKSPYSMDANLLHISYEGGVLED 196 ******************987*************99862367889******************* PP TIGR00032 189 psteppediyelvkdpiektedepevveieFekGvPvalngeslepvelilkaneiagkhGvGr 252 +te ed+++++++p++++ d+p+++e+++++G val+g++++p +++ ++n+i+g+hG+Gr lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5590 197 TWTEHEEDMWRWTVSPEKAP-DTPQYLELTYRNGDIVALDGVEMSPATVLATLNRIGGEHGIGR 259 **************988887.******************************************* PP TIGR00032 253 iDivEdRiiglKsReiYEapalllLikAhkdLetlvltkdvlefkeiveekyseliYkGlwfdp 316 +DivE+R++g+KsR++YE+p+ +++++Ah+++e+ +l+++v+++k+ ky+ liY+G+w++p lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5590 260 LDIVENRYVGMKSRGCYETPGGTIMLRAHRAIESITLDREVAHLKDELMPKYASLIYTGYWWSP 323 **************************************************************** PP TIGR00032 317 laealdalikktqervtGtvrvklfkGnaivigrkseyslYdeelvsfek.dkefdqkdaiGfi 379 ++ +l+ +i+ +q +v+G+vr+kl+kGn+iv grks++sl+d+++++fe+ +++q da+Gfi lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5590 324 ERLMLQQMIDASQAHVNGVVRLKLYKGNVIVTGRKSDESLFDANIATFEEdGGAYNQADAAGFI 387 *************************************************9456899******** PP TIGR00032 380 kirglqikvyre 391 k+++l++++ ++ lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5590 388 KLNALRMRIAAN 399 ******988765 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (394 nodes) Target sequences: 1 (405 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.26 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory