Align Glutamyl-tRNA(Gln) amidotransferase subunit A; Glu-ADT subunit A; EC 6.3.5.7 (uncharacterized)
to candidate Pf6N2E2_3707 Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases
Query= curated2:Q1J0C2 (483 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3707 Length = 457 Score = 166 bits (419), Expect = 2e-45 Identities = 150/478 (31%), Positives = 227/478 (47%), Gaps = 53/478 (11%) Query: 7 ATDLARAVQARETTPQALLEAARRRAEAARDLNALISLND-RADEQAARVQVRLDAGETL 65 A LA A + T P +LE A +A A + +SL + RA +A R AG+ L Sbjct: 13 AIALAEAFASGRTDPVQVLEQALEQASRAE--HVFVSLTEARARREAQASAARWRAGQPL 70 Query: 66 P-LAGVPIVVKDNLNVIGTRTTCGSRILANYVSPY-DATAVERLTGAGAVIIGKANMDEF 123 GVP+ KD +V G+ TT + + + DA +V L+ AG V +GK N+ EF Sbjct: 71 SGFDGVPLAWKDLFDVAGSVTTAAAAVRRDAPPALLDAASVSLLSRAGMVCLGKTNLSEF 130 Query: 124 AMGSSTESSAWGPTLNPWD--RERVPGGSSGGSAVAVAANLTPVALGSDTGGSVRQPAAF 181 A + +G +NP+ + R+PGGSS GSAVAVAA + P+A+G+DT GS+R PAAF Sbjct: 131 AYSGLGLNPHFGTPVNPFSDAQPRIPGGSSSGSAVAVAAGIVPIAMGTDTAGSIRVPAAF 190 Query: 182 TGIYGLKPTYGRVSRYGLVAYASSLDQIGPFARSAADLALLMNVLAGHDPRDATSLDAPP 241 + G + + R SR G+ A S+D IGP RS D ++ +L G DPR APP Sbjct: 191 NALVGFRASSRRHSRDGVFPLAHSIDSIGPLTRSVRDAWMIDELLQGRDPR-----QAPP 245 Query: 242 AFRPGTPDDLQGLRVGVIREALEGNTPGVEAALNAT----LDALRGAGATVREVSVPSVQ 297 L G R V + LE VEAA+ A + ALR AGA V +P+ Q Sbjct: 246 V------RSLAGQRFWVEQAVLE--DASVEAAVRANVLAGVQALRTAGALVEIRPLPAFQ 297 Query: 298 HAIAAYYLIATPEASSNLARYDGMVYGERVSAPDAVSSMTLTREQGFGREVKRRIMLGTY 357 ++A A+ A ++ + + + DA + V+RR+ Sbjct: 298 ASLALIRDHGWLGAAEAFALHEAL-----LDSADA---------ERLDPRVRRRLEAARP 343 Query: 358 ALSSGYYDAYYSKAMKVRRLIAQ-DFARAFGNVDVLVTPTSPFPAFRRGEKTQDPLAMYA 416 +S Y +++ R+L+ + D A VL+TPT A D Sbjct: 344 MTASQVLKLYDARSALQRQLVEELDGA-------VLITPTVAHVAPPLAPLEADDELFVR 396 Query: 417 ADVDTVAINLAG----LPALSVPAGFERVDGVRLPVGVQLIAPPLQDERLVALAGGLE 470 ++ T+ + + G +P++++P+G D LP G+ L P +D RL+ +A +E Sbjct: 397 TNLATLRLTMPGSLLDMPSVNLPSG---RDSQGLPTGLLLSVPQGEDARLLRVARSVE 451 Lambda K H 0.316 0.132 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 518 Number of extensions: 27 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 483 Length of database: 457 Length adjustment: 33 Effective length of query: 450 Effective length of database: 424 Effective search space: 190800 Effective search space used: 190800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory